PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KHN28509.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 88aa MW: 10265.9 Da PI: 10.4579 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.4 | 3.7e-09 | 2 | 38 | 10 | 47 |
HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 el+ + +++G+g+Wk I+r + +R + q+ s+ qky KHN28509.1 2 ELFMLGLQKYGKGDWKNISRIIK-TRNPTQVASHVQKY 38 789999****************9.*************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.872 | 1 | 43 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.59E-10 | 2 | 43 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.3E-6 | 2 | 38 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-5 | 2 | 37 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.50E-6 | 2 | 39 | No hit | No description |
TIGRFAMs | TIGR01557 | 6.4E-10 | 3 | 40 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MELFMLGLQK YGKGDWKNIS RIIKTRNPTQ VASHVQKYFL LQASSNKGKR RSIHDMVLPD 60 GPVPHRIYQQ NEVSFPNLYV PITHHIDH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KHN28509.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010418602.1 | 2e-20 | PREDICTED: transcription factor DIVARICATA-like | ||||
Refseq | XP_027908514.1 | 1e-20 | transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 1e-17 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A0B2R8L5 | 2e-59 | A0A0B2R8L5_GLYSO; Transcription factor MYB1R1 | ||||
STRING | XP_010418602.1 | 8e-20 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13860 | 4 | 14 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 8e-21 | Homeodomain-like transcriptional regulator |
Publications ? help Back to Top | |||
---|---|---|---|
|