PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.013G205200.1

Common Name

B456_013G205200, LOC105782338

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NF-YB

Protein Properties

Length: 137aa MW: 15356.1 Da PI: 5.3187

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.013G205200.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	163.2	3.7e-51	3	98	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 eq+r+lPianv+rimk++lP nak+sk+ak+t+qec++efisfvt+easdkc++e+rkt+ngdd++wal+ lGf++y++++ yl+kyre+e Gorai.013G205200.1 3 DEQERLLPIANVGRIMKQILPPNAKVSKEAKQTLQECATEFISFVTGEASDKCRKENRKTVNGDDICWALGALGFDNYADAIVRYLHKYREIE 95 69******************************************************************************************* PP NF-YB 95 gek 97 ++k Gorai.013G205200.1 96 RDK 98 *97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.1E-49	2	129	IPR009072	Histone-fold
SuperFamily	SSF47113	1.19E-38	5	122	IPR009072	Histone-fold
Pfam	PF00808	5.0E-26	8	72	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	4.9E-16	36	54	No hit	No description
PROSITE pattern	PS00685	0	39	55	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	4.9E-16	55	73	No hit	No description
PRINTS	PR00615	4.9E-16	74	92	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MVDEQERLLP IANVGRIMKQ ILPPNAKVSK EAKQTLQECA TEFISFVTGE ASDKCRKENR 60 KTVNGDDICW ALGALGFDNY ADAIVRYLHK YREIERDKAT QNKATCISSQ DKDEESSEDR 120 SNQPPHQQAE APSTRV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-40	2	93	1	92	Transcription factor HapC (Eurofung)
4g92_B	2e-40	2	93	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00133	DAP	Transfer from AT1G09030	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ567167	6e-61	AJ567167.1 Gossypium hirsutum microsatellite DNA mGhCIR221, clone CIR221.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012462479.1	7e-99	PREDICTED: nuclear transcription factor Y subunit B-4-like
Swissprot	O04027	1e-56	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A0D2SHE0	2e-97	A0A0D2SHE0_GOSRA; Uncharacterized protein
STRING	Gorai.013G205200.1	3e-98	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	7e-57	nuclear factor Y, subunit B4

Link Out ? help Back to Top
Phytozome	Gorai.013G205200.1
Entrez Gene	105782338

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]