PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.012G037600.2

Common Name

B456_012G037600

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 223aa MW: 25738.2 Da PI: 6.7961

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.012G037600.2	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	95	1.2e-29	5	77	54	128
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekewyfFs+rd+ky++g r+nra+ +gyWkatg dk++ + ++ g+kk Lvfy g+ap+g+kt+W+mheyrl Gorai.012G037600.2 5 GEKEWYFFSPRDRKYPNGCRPNRAAGTGYWKATGADKPIGK--PKTLGIKKALVFYAGKAPRGVKTNWIMHEYRL 77 579**********************************98..778*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	40.734	1	104	IPR003441	NAC domain
SuperFamily	SSF101941	5.89E-36	3	104	IPR003441	NAC domain
Pfam	PF02365	6.9E-15	9	77	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0008361	Biological Process	regulation of cell size
GO:0009416	Biological Process	response to light stimulus
GO:0009611	Biological Process	response to wounding
GO:0009620	Biological Process	response to fungus
GO:0009744	Biological Process	response to sucrose
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0043424	Molecular Function	protein histidine kinase binding

Sequence ? help Back to Top
Protein Sequence Length: 223 aa Download sequence Send to blast
MALYGEKEWY FFSPRDRKYP NGCRPNRAAG TGYWKATGAD KPIGKPKTLG IKKALVFYAG 60 KAPRGVKTNW IMHEYRLANV DRSAGKKSNN LRLDDWVLCR IYNKKGSIEK HFPSEQKSLS 120 YPEMEDEKPD IIMNGQNMQQ PWSVMAMKND VIQTDGSESS WSEHVPSPEI TWEKEVKSEG 180 RWNELDFGLD FIDEDPFASQ VDYQMEQLSP LQDMFMYLPK TF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	4e-50	2	110	64	174	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, cotyledons, rosette leaves, cauline leaves and mature flowers. Expressed at low levels in stems and flower buds. {ECO:0000269\|PubMed:16115070}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in disease resistance response (PubMed:16115070, PubMed:19625399). May function as repressor of pathogenesis-related proteins (PubMed:16115070). May function in the regulation of host basal defense responses against viral infection (PubMed:19625399). Transcriptional activator involved in responses to wounding and infection with tobamovirus (TMV) (PubMed:22937923). Binds to the DNA sequences 5'-AAAATATCT-3' and 5'AGATTTTT-3' of CYP734A1/BAS1 and CYP72C1/SOB7 promoters, respectively. Acts as suppressor of the brassinosteroid (BR)-inactivating enzymes CYP734A1/BAS1 and CYP72C1/SOB7, and prevents their expression in almost all tissues. Plays a central role in integrating BR homeostasis and seedling development. Regulates the spatial regulation of BR homeostasis and participates in the regulation of hypocotyl elongation and root growth by suppressing BR catabolism. Mediates connection between BR catabolism and photomorphogenesis (PubMed:26493403). Binds to, and transactivates the promoter of the auxin biosynthetic gene NIT2 (PubMed:22965747). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16115070, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:19625399, ECO:0000269\|PubMed:22937923, ECO:0000269\|PubMed:22965747, ECO:0000269\|PubMed:26493403, ECO:0000269\|PubMed:26518251}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding, salicylic acid (SA), methyl jasmonate, drought stress, dark and sucrose starvation (PubMed:16115070). Induced by chitin elicitor (chitooctaose) (PubMed:17722694). Induced by salicylic acid and infection with tobamovirus (TMV) (PubMed:19625399). By indole-3-acetonitrile, salicylic acid (SA), sodium nitroprusside (SNP), salt stress and drought stress (PubMed:22965747). Down-regulated by brassinosteroid (BR) and transition from dark to white light (PubMed:26493403). {ECO:0000269\|PubMed:16115070, ECO:0000269\|PubMed:17722694, ECO:0000269\|PubMed:19625399, ECO:0000269\|PubMed:22965747, ECO:0000269\|PubMed:26493403}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU706338	0.0	EU706338.1 Gossypium hirsutum NAC domain protein NAC1 (NAC1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016751388.1	1e-167	PREDICTED: protein ATAF2-like isoform X2
Swissprot	Q9C598	5e-82	NAC81_ARATH; Protein ATAF2
TrEMBL	A0A0D2V1B4	1e-166	A0A0D2V1B4_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8PM36	1e-166	A0A1U8PM36_GOSHI; protein ATAF2-like isoform X2
STRING	Gorai.012G037600.1	1e-165	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G08790.1	2e-84	NAC family protein

Link Out ? help Back to Top
Phytozome	Gorai.012G037600.2

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251]