PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.009G040900.1 | ||||||||
Common Name | B456_009G040900, LOC105767566 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 191aa MW: 21920.7 Da PI: 8.3173 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.6 | 8.1e-20 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd++l+++v+ +G+++W ++a++ g++R++k+c++rw++yl Gorai.009G040900.1 18 RGAWTDEEDQKLAQVVEIYGPKRWQAVAAKAGLNRSGKSCRLRWLNYL 65 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.9 | 3.6e-16 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gorai.009G040900.1 71 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 116 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.715 | 13 | 69 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.44E-30 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-17 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-19 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-24 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.60E-12 | 20 | 65 | No hit | No description |
SMART | SM00717 | 1.9E-15 | 70 | 118 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.215 | 70 | 120 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.5E-14 | 71 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-24 | 73 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.34E-10 | 75 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MPVAPPISTK CSKKEVNRGA WTDEEDQKLA QVVEIYGPKR WQAVAAKAGL NRSGKSCRLR 60 WLNYLRPNIK RGNISDQEED LILRLHKLLG NRWSLIAGRL PGRTDNEIKN YWNSHLSKKT 120 KQNEKQTIGS RMQEPVLENC KVSESKRDEN STACFINGDD SLFDSYSEEP LNLEWTSHFF 180 ETDELWLNLA * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 3e-31 | 15 | 120 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 4e-31 | 15 | 120 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX582297 | 2e-43 | JX582297.1 Gossypium hirsutum clone NBRI_GE15106 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012442588.1 | 1e-140 | PREDICTED: transcription factor MYB114-like isoform X1 | ||||
Swissprot | P10290 | 2e-50 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A0D2TDA6 | 1e-138 | A0A0D2TDA6_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.009G040900.1 | 1e-139 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 1e-51 | myb domain protein 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.009G040900.1 |
Entrez Gene | 105767566 |