PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.006G045100.1 | ||||||||
Common Name | B456_006G045100, LOC105798483 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 242aa MW: 27902.7 Da PI: 8.5873 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.9 | 7.5e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +rienk+nrqvtfskRrng+lKK +ELSvLCdaeva+iifss+gkl e++s Gorai.006G045100.1 9 ERIENKINRQVTFSKRRNGLLKKSYELSVLCDAEVALIIFSSRGKLSEFAS 59 69***********************************************86 PP | |||||||
2 | K-box | 88.4 | 1.4e-29 | 83 | 171 | 11 | 99 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++++l+qe+ +Lk+++e+Lqr+qRhllGe+LesL++keL ++e+qL+++l++ R+kK++llle +eel kke+el+ enk+L+++le Gorai.006G045100.1 83 LDETQTLYQEVLRLKAKYESLQRSQRHLLGEELESLTVKELYKIEKQLDRALSQARQKKTQLLLERMEELSKKERELEVENKQLKSQLE 171 5679*********************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.2E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.006 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.71E-37 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 9.16E-30 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.8E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.4E-25 | 85 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.422 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MGRGKVVLER IENKINRQVT FSKRRNGLLK KSYELSVLCD AEVALIIFSS RGKLSEFASN 60 ISVPTTLEKY WQHRYSSPVD IPLDETQTLY QEVLRLKAKY ESLQRSQRHL LGEELESLTV 120 KELYKIEKQL DRALSQARQK KTQLLLERME ELSKKERELE VENKQLKSQL ELEHCFQSAQ 180 GLGDCSIEMG NEYNMIPSQA NHAQQQSSTH TGYHQFIPQE RVTEDRTVNR SGANKCTAGW 240 L* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
6byy_B | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
6byy_C | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
6byy_D | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
6bz1_A | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 1 | 78 | 1 | 75 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development in the inner and outer integuments. Not detected in young panicles. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:19820190}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the floral meristem. Highly expressed in lodicules. Expressed in palea and pistil. Weakly expressed in carpels, empty glumes and stamens. Not detected in lemmas. {ECO:0000269|PubMed:10444103, ECO:0000269|PubMed:19820190}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX587995 | 2e-62 | JX587995.1 Gossypium hirsutum clone NBRI_GE22289 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012484024.1 | 1e-178 | PREDICTED: MADS-box transcription factor 6-like isoform X1 | ||||
Swissprot | Q6EU39 | 6e-77 | MADS6_ORYSJ; MADS-box transcription factor 6 | ||||
TrEMBL | A0A0D2RQF3 | 1e-177 | A0A0D2RQF3_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.006G045100.1 | 1e-178 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM25059 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 2e-66 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.006G045100.1 |
Entrez Gene | 105798483 |