PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.004G063800.1

Common Name

B456_004G063800, LOC105793536

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

bZIP

Protein Properties

Length: 168aa MW: 19419.7 Da PI: 6.1514

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.004G063800.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	49.4	1e-15	73	125	5	57
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 +++rr+++NRe+ArrsR RK+ ++eL v L +eN++L+++l++ ++ + Gorai.004G063800.1 73 RKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHVSESHD 125 689***************************************99999887655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.880.10	8.1E-5	36	87	IPR008917	Transcription factor, Skn-1-like, DNA-binding domain
SMART	SM00338	1.4E-14	69	133	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.588	71	134	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.3E-13	73	125	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.05E-13	73	123	No hit	No description
CDD	cd14702	6.21E-19	74	125	No hit	No description
PROSITE pattern	PS00036	0	76	91	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.0E-12	88	146	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MQPSEISGLQ YIVPSNPSPY SVPAFELSRF SNPLHNLYIP PQLQEIISPH PSCINNSTSD 60 EADEQQLCVI NERKQRRMIS NRESARRSRM RKQRHLDELW SQVVWLRNEN HQLIDKLNHV 120 SESHDKVVEE NVQLKEEASQ LRRMLSDVQL TSPYSPLTDL EHALADN*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	85	92	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00389	DAP	Transfer from AT3G30530	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012477888.1	1e-119	PREDICTED: basic leucine zipper 43-like
Refseq	XP_016700168.1	1e-119	PREDICTED: basic leucine zipper 43-like
Swissprot	Q9FMC2	6e-44	BZP43_ARATH; Basic leucine zipper 43
TrEMBL	A0A0D2R028	1e-117	A0A0D2R028_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8KGT9	1e-117	A0A1U8KGT9_GOSHI; basic leucine zipper 43-like
TrEMBL	A0A2P5SSY0	1e-117	A0A2P5SSY0_GOSBA; Uncharacterized protein
STRING	Gorai.004G063800.1	1e-118	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3112	26	67

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G30530.1	2e-51	basic leucine-zipper 42

Link Out ? help Back to Top
Phytozome	Gorai.004G063800.1
Entrez Gene	105793536

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]