PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.003G035400.1 | ||||||||
Common Name | B456_003G035400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 99aa MW: 11597.3 Da PI: 9.9492 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 62.3 | 7e-20 | 20 | 73 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ +q+++Le+ F +++ e++ +LA++lgL+ rqV +WFqNrRa++k Gorai.003G035400.1 20 KKRRLSMHQVKALEKNFDVGNKLEPERKVKLAEELGLQPRQVAIWFQNRRARWK 73 56689************************************************9 PP | |||||||
2 | HD-ZIP_I/II | 111 | 8e-36 | 19 | 89 | 1 | 71 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkrayd 71 ekkrrls +qvk+LE++F+ +kLeperKv+la+eLglqprqva+WFqnrRAR+ktk lEkdy++Lk++ + Gorai.003G035400.1 19 EKKRRLSMHQVKALEKNFDVGNKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKVLEKDYAMLKANRE 89 69*****************************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.34E-19 | 13 | 75 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 17.475 | 15 | 75 | IPR001356 | Homeobox domain |
SMART | SM00389 | 4.6E-18 | 18 | 79 | IPR001356 | Homeobox domain |
CDD | cd00086 | 3.66E-14 | 20 | 75 | No hit | No description |
Pfam | PF00046 | 3.9E-17 | 20 | 73 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 4.4E-20 | 27 | 74 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 1.8E-6 | 46 | 55 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 50 | 73 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 1.8E-6 | 55 | 71 | IPR000047 | Helix-turn-helix motif |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
MLDGLDEEDN LEEGGQATEK KRRLSMHQVK ALEKNFDVGN KLEPERKVKL AEELGLQPRQ 60 VAIWFQNRRA RWKTKVLEKD YAMLKANREK EPLWKSFS* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Localized primarily to the hypocotyl of germinating seedlings. {ECO:0000269|PubMed:12678559}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'. {ECO:0000269|PubMed:12678559}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:12678559, ECO:0000269|PubMed:16055682}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC243121 | 1e-156 | AC243121.1 Gossypium raimondii clone GR__Ba0142D21-hnv, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012477717.1 | 7e-63 | PREDICTED: homeobox-leucine zipper protein ATHB-6-like, partial | ||||
Swissprot | P46667 | 3e-36 | ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5 | ||||
TrEMBL | A0A0D2NVT7 | 4e-64 | A0A0D2NVT7_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.003G035400.1 | 6e-65 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM545 | 28 | 143 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65310.2 | 1e-36 | homeobox protein 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.003G035400.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|