PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.002G099900.1

Common Name

B456_002G099900, LOC105781791

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NF-YB

Protein Properties

Length: 185aa MW: 19760.2 Da PI: 7.6249

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.002G099900.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	184.5	8.5e-58	29	124	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 +eqdrflPianv+rimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re Gorai.002G099900.1 29 KEQDRFLPIANVGRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFRE 119 79*************************************************************************************** PP NF-YB 93 legek 97 +egek Gorai.002G099900.1 120 MEGEK 124 *97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.3E-54	23	131	IPR009072	Histone-fold
SuperFamily	SSF47113	4.66E-41	31	132	IPR009072	Histone-fold
Pfam	PF00808	3.1E-28	34	98	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	8.7E-21	62	80	No hit	No description
PROSITE pattern	PS00685	0	65	81	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	8.7E-21	81	99	No hit	No description
PRINTS	PR00615	8.7E-21	100	118	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MADSDSESGG AQNNASNAAG NNNHLFSPKE QDRFLPIANV GRIMKKALPA NAKISKEAKE 60 TVQECVSEFI SFITGEASDK CQKEKRKTIN GDDLLWAMTT LGFEDYVEPL KVYLQRFREM 120 EGEKTTVARD KDAPLVAASG GGGGGVYGMM VHQHQGHVYG STGFHQMGSG LGKGGPPNNL 180 GRPK*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-48	29	119	2	92	Transcription factor HapC (Eurofung)
4g92_B	2e-48	29	119	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Gra.332	1e-111	flower\|seedling\| flowering

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HQ527494	1e-132	HQ527494.1 Gossypium herbaceum clone NBRI_B2_815 simple sequence repeat marker, mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012461775.1	1e-136	PREDICTED: nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	3e-68	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A0D2QAI2	1e-135	A0A0D2QAI2_GOSRA; Uncharacterized protein
STRING	Gorai.002G099900.1	1e-136	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47640.1	2e-67	nuclear factor Y, subunit B2

Link Out ? help Back to Top
Phytozome	Gorai.002G099900.1
Entrez Gene	105781791

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]