PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G47640.1

Common Name

HAP3B, MNJ7.23, NFYB2, NF-YB2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NF-YB

Protein Properties

Length: 190aa MW: 20529.5 Da PI: 6.5143

Description

nuclear factor Y, subunit B2

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G47640.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	185.7	3.6e-58	26	121	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege+ AT5G47640.1 26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 121 89********************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.7E-54	20	128	IPR009072	Histone-fold
SuperFamily	SSF47113	1.55E-41	28	138	IPR009072	Histone-fold
Pfam	PF00808	1.2E-28	31	95	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	7.3E-21	59	77	No hit	No description
PROSITE pattern	PS00685	0	62	78	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	7.3E-21	78	96	No hit	No description
PRINTS	PR00615	7.3E-21	97	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 190 aa Download sequence Send to blast
MGDSDRDSGG GQNGNNQNGQ SSLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ 60 ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKVY LQRFREIEGE 120 RTGLGRPQTG GEVGEHQRDA VGDGGGFYGG GGGMQYHQHH QFLHQQNHMY GATGGGSDSG 180 GGAASGRTRT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-48	26	116	2	92	Transcription factor HapC (Eurofung)
4g92_B	1e-48	26	116	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.21494	0.0	seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145358966	0.0
Genevisible	248764_at	0.0
Expression Atlas	AT5G47640	-
AtGenExpress	AT5G47640	-
ATTED-II	AT5G47640	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:9662544}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Function -- GeneRIF ? help Back to Top
can promote flowering by enhancing expression of key flowering time genes such as FLOWERING LOCUS T and SUPPRESSOR OF OVEREXPRESSION OF CONSTANS1 [PMID: 17631525] Our results provide evidence to support a role of HAP3b in regulation of root growth. [HAP3b] [PMID: 21316979]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G47640.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G14920, AT1G28050, AT1G54830, AT1G56170

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G47640

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB025628	0.0	AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
GenBank	AF385744	0.0	AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBank	AY078026	0.0	AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_199575.1	1e-139	nuclear factor Y, subunit B2
Swissprot	Q9FGJ3	1e-140	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	A0A178UPH7	1e-138	A0A178UPH7_ARATH; NF-YB2
STRING	AT5G47640.1	1e-139	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229
Representative plant	OGRP168	17	170

Link Out ? help Back to Top
Phytozome	AT5G47640.1
Entrez Gene	834815
iHOP	AT5G47640
wikigenes	AT5G47640

Publications ? help Back to Top
Kleinow T, et al. Functional identification of an Arabidopsis snf4 ortholog by screening for heterologous multicopy suppressors of snf4 deficiency in yeast. Plant J., 2000. 23(1): p. 115-22 [PMID:10929106] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Gusmaroli G,Tonelli C,Mantovani R Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana. Gene, 2001. 264(2): p. 173-85 [PMID:11250072] Gusmaroli G,Tonelli C,Mantovani R Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits. Gene, 2002. 283(1-2): p. 41-8 [PMID:11867211] Kreps JA, et al. Transcriptome changes for Arabidopsis in response to salt, osmotic, and cold stress. Plant Physiol., 2002. 130(4): p. 2129-41 [PMID:12481097] Kwong RW, et al. LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development. Plant Cell, 2003. 15(1): p. 5-18 [PMID:12509518] Hudson ME,Lisch DR,Quail PH The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway. Plant J., 2003. 34(4): p. 453-71 [PMID:12753585] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Stevens R, et al. A CDC45 homolog in Arabidopsis is essential for meiosis, as shown by RNA interference-induced gene silencing. Plant Cell, 2004. 16(1): p. 99-113 [PMID:14660803] Sharma N,Cram D,Huebert T,Zhou N,Parkin IA Exploiting the wild crucifer Thlaspi arvense to identify conserved and novel genes expressed during a plant's response to cold stress. Plant Mol. Biol., 2007. 63(2): p. 171-84 [PMID:16972165] Wenkel S, et al. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell, 2006. 18(11): p. 2971-84 [PMID:17138697] Xin Z,Mandaokar A,Chen J,Last RL,Browse J Arabidopsis ESK1 encodes a novel regulator of freezing tolerance. Plant J., 2007. 49(5): p. 786-99 [PMID:17316173] Cai X, et al. A putative CCAAT-binding transcription factor is a regulator of flowering timing in Arabidopsis. Plant Physiol., 2007. 145(1): p. 98-105 [PMID:17631525] Peng M,Bi YM,Zhu T,Rothstein SJ Genome-wide analysis of Arabidopsis responsive transcriptome to nitrogen limitation and its regulation by the ubiquitin ligase gene NLA. Plant Mol. Biol., 2007. 65(6): p. 775-97 [PMID:17885809] Jakoby MJ, et al. Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. Plant Physiol., 2008. 148(3): p. 1583-602 [PMID:18805951] Richardt S, et al. Microarray analysis of the moss Physcomitrella patens reveals evolutionarily conserved transcriptional regulation of salt stress and abscisic acid signalling. Plant Mol. Biol., 2010. 72(1-2): p. 27-45 [PMID:19806323] Kumimoto RW,Zhang Y,Siefers N,Holt BF NF-YC3, NF-YC4 and NF-YC9 are required for CONSTANS-mediated, photoperiod-dependent flowering in Arabidopsis thaliana. Plant J., 2010. 63(3): p. 379-91 [PMID:20487380] Shin R,Jez JM,Basra A,Zhang B,Schachtman DP 14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] Ballif J,Endo S,Kotani M,MacAdam J,Wu Y Over-expression of HAP3b enhances primary root elongation in Arabidopsis. Plant Physiol. Biochem., 2011. 49(6): p. 579-83 [PMID:21316979] Liang M,Hole D,Wu J,Blake T,Wu Y Expression and functional analysis of NUCLEAR FACTOR-Y, subunit B genes in barley. Planta, 2012. 235(4): p. 779-91 [PMID:22042327] Hackenberg D, et al. Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y. Mol Plant, 2012. 5(4): p. 876-88 [PMID:22199235] Calvenzani V, et al. Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits. PLoS ONE, 2012. 7(8): p. e42902 [PMID:22912760] Hou X, et al. Nuclear factor Y-mediated H3K27me3 demethylation of the SOC1 locus orchestrates flowering responses of Arabidopsis. Nat Commun, 2014. 5: p. 4601 [PMID:25105952] Sato H, et al. Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits. Plant Cell, 2014. 26(12): p. 4954-73 [PMID:25490919] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714] Edwards D,Murray JA,Smith AG Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis. Plant Physiol., 1998. 117(3): p. 1015-22 [PMID:9662544]