PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.001G155700.1 | ||||||||
Common Name | B456_001G155700, LOC105796076 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 84aa MW: 9895.28 Da PI: 8.2185 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.2 | 3.7e-08 | 29 | 68 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++E++l+++ k+ G + W++Ia +++ gR ++++ +w Gorai.001G155700.1 29 MSEQEEDLIYRMYKLVGDK-WALIAGRIP-GRKAEEIERFWI 68 79***************99.*********.*********995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.2E-5 | 25 | 73 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.08E-5 | 28 | 67 | No hit | No description |
Pfam | PF00249 | 1.7E-7 | 29 | 68 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.7E-7 | 30 | 68 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.6E-10 | 30 | 68 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MDGRRRKQPK TSGCCSEEVS SIEWEFINMS EQEEDLIYRM YKLVGDKWAL IAGRIPGRKA 60 EEIERFWIMR HGEGFANRRR ELS* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN997399 | 1e-134 | JN997399.1 Gossypium arboreum caprice (CPC) mRNA, complete cds. | |||
GenBank | JN997402 | 1e-134 | JN997402.1 Gossypium hirsutum CPC-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012481169.1 | 3e-55 | PREDICTED: transcription factor CPC-like | ||||
Swissprot | Q8GV05 | 2e-38 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A0D2QR36 | 8e-54 | A0A0D2QR36_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.001G155700.1 | 1e-54 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 6e-41 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.001G155700.1 |
Entrez Gene | 105796076 |