PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gorai.001G107900.1 | ||||||||
Common Name | B456_001G107900, LOC105791081 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 248aa MW: 28413.8 Da PI: 6.2534 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.3 | 1.5e-17 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed ll++ v+++G ++W+ Ia+ g++Rt+k+c++rw +yl Gorai.001G107900.1 8 KGPWTEQEDILLANFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 55 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.3 | 3.1e-17 | 61 | 106 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ Gorai.001G107900.1 61 RGKMTPHEERLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 106 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.369 | 3 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.42E-29 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-15 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-16 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-20 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.90E-11 | 10 | 55 | No hit | No description |
PROSITE profile | PS51294 | 25.776 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-16 | 60 | 108 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.1E-15 | 61 | 105 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-23 | 63 | 108 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.41E-12 | 63 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 248 aa Download sequence Send to blast |
MVQDEIRKGP WTEQEDILLA NFVHLFGDRR WDFIAKVSGL NRTGKSCRLR WVNYLHPGLK 60 RGKMTPHEER LVLELHAKWG NRWSRIARKL PGRTDNEIKN YWRTHMRKTA QEKKRAIPIS 120 PSSSSSNCHS SSSTVTTVDS LPSSGTGNIV SFYDTGGLDM AGKKNSPEFE DGNGYSMDDI 180 WKDIDMPEED TIIKPLPDNY SQQGCNFSWE YCWDSLWKMD DEEESKMFFP PNQLVSCFDF 240 GTESVTG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 8e-27 | 5 | 110 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 3e-26 | 1 | 110 | 51 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 3e-26 | 1 | 110 | 51 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00600 | PBM | Transfer from AT5G59780 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012474427.1 | 0.0 | PREDICTED: transcription factor MYB59-like isoform X1 | ||||
Swissprot | Q4JL84 | 3e-92 | MYB59_ARATH; Transcription factor MYB59 | ||||
Swissprot | Q9LX82 | 3e-92 | MYB48_ARATH; Transcription factor MYB48 | ||||
TrEMBL | A0A0D2PWT3 | 0.0 | A0A0D2PWT3_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.001G107900.1 | 0.0 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2502 | 27 | 74 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.3 | 4e-91 | myb domain protein 59 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Gorai.001G107900.1 |
Entrez Gene | 105791081 |