PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.20G234900.2.p | ||||||||
Common Name | GLYMA_20G234900, LOC100791116 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 121aa MW: 13611.4 Da PI: 8.4773 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 125.6 | 1.9e-39 | 1 | 81 | 17 | 97 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mk++lP akisk+ k+++qecv+efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++ yl+ yr+ e+ek Glyma.20G234900.2.p 1 MKQILPPSAKISKEGKQLMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYAEAIGRYLHIYRQGEREK 81 9***************************************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 6.61E-29 | 1 | 92 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 2.2E-37 | 1 | 94 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.0E-18 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-16 | 19 | 37 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-16 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.5E-16 | 57 | 75 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MKQILPPSAK ISKEGKQLMQ ECVTEFISFV TGEASDKCHK ENRKTVNGDD ICWALSSLGF 60 DNYAEAIGRY LHIYRQGERE KINHTKKYEN PQNQTQINRA PPPPLLLSRV ENPPPTNQSG 120 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-31 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-31 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.25616 | 1e-124 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00133 | DAP | Transfer from AT1G09030 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.20G234900.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC235914 | 1e-122 | AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003555607.1 | 9e-87 | nuclear transcription factor Y subunit B-4 | ||||
Refseq | XP_028219542.1 | 9e-87 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 9e-46 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A445F9F7 | 1e-84 | A0A445F9F7_GLYSO; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | K7N593 | 2e-85 | K7N593_SOYBN; Uncharacterized protein | ||||
TrEMBL | K7N594 | 2e-85 | K7N594_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA20G37870.2 | 3e-86 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 4e-48 | nuclear factor Y, subunit B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.20G234900.2.p |
Entrez Gene | 100791116 |
Publications ? help Back to Top | |||
---|---|---|---|
|