PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.20G050400.1.p | ||||||||
Common Name | GLYMA_20G050400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 149aa MW: 17173.8 Da PI: 10.6038 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 50.7 | 2.3e-16 | 11 | 52 | 3 | 44 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44 i n ++r+ t+skR+ng++KK E+S+LC++e++ i + +++ Glyma.20G050400.1.p 11 ITNARKRKATLSKRKNGLIKKMDEISTLCGIEACAIFYTPNN 52 89************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 16.792 | 1 | 52 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.2E-20 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 6.88E-26 | 2 | 82 | No hit | No description |
PRINTS | PR00404 | 1.8E-9 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.19E-23 | 3 | 95 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.6E-16 | 11 | 52 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-9 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-9 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 149 aa Download sequence Send to blast |
MARKKVDLSY ITNARKRKAT LSKRKNGLIK KMDEISTLCG IEACAIFYTP NNPQPEVWPS 60 DSGAQSVLSR FRKVSELEQS KKKLSQESFL RQRINKAKKK EVTLLMFQNL NAKNNFENSN 120 MIDLNDVSNL INHNLEEVKR KINMSQAQE |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 2 | 17 | RKKVDLSYITNARKRK |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.20G050400.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028220242.1 | 1e-102 | agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 5e-38 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | A0A0R0E743 | 1e-104 | A0A0R0E743_SOYBN; Uncharacterized protein (Fragment) | ||||
STRING | XP_007146077.1 | 6e-74 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF452 | 33 | 154 | Representative plant | OGRP114 | 13 | 173 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 2e-40 | AGAMOUS-like 80 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.20G050400.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|