PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.17G224800.4.p | ||||||||
Common Name | GLYMA_17G224800, LOC100796836 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 164aa MW: 18732.4 Da PI: 5.6449 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.5 | 5e-32 | 102 | 160 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+ gC+vkk+ver+++dp++v++tYeg+H+h+ Glyma.17G224800.4.p 102 LDDGYRWRKYGKKMVKNSPNPRNYYRCSVDGCNVKKRVERDKDDPRYVITTYEGNHTHP 160 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.6E-34 | 88 | 161 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.75E-29 | 95 | 161 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.066 | 97 | 162 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.7E-37 | 102 | 161 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.7E-25 | 103 | 160 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MTDKIPKPPP PDTPDSDDFT NQWPFELSEY LKFDDNQWMH DGLESFASEN VSNQVHQVSN 60 AGEFGGGSSH FEGSSSNTSS GRENREVRER VAFKIMSEIE VLDDGYRWRK YGKKMVKNSP 120 NPRNYYRCSV DGCNVKKRVE RDKDDPRYVI TTYEGNHTHP SSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 9e-26 | 92 | 159 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 9e-26 | 92 | 159 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.17G224800.4.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 2e-33 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014625132.1 | 1e-120 | probable WRKY transcription factor 50 isoform X2 | ||||
Refseq | XP_028210038.1 | 1e-120 | probable WRKY transcription factor 50 isoform X2 | ||||
Swissprot | Q8VWQ5 | 3e-40 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A0R0FQ53 | 1e-119 | A0A0R0FQ53_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA17G34210.2 | 1e-102 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 3e-41 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.17G224800.4.p |
Entrez Gene | 100796836 |
Publications ? help Back to Top | |||
---|---|---|---|
|