PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.17G051400.2.p | ||||||||
Common Name | GLYMA_17G051400, LOC100777544 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 190aa MW: 20509.1 Da PI: 10.1138 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.8 | 3.7e-33 | 49 | 105 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d p+YVNaKQy++Il+RRq+Rakle+++kl +ksrkpylheSRh+hAl+R RgsgGrF Glyma.17G051400.2.p 49 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-IKSRKPYLHESRHRHALNRVRGSGGRF 105 57****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 1.4E-36 | 47 | 108 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.834 | 48 | 108 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 7.1E-25 | 51 | 73 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 2.2E-28 | 51 | 105 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 53 | 73 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 7.1E-25 | 82 | 105 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MKPFLSNHTD SMYNCSQVGC SHPMNQQMVP QMLGLASTRI ALPVDLAEDG PIYVNAKQYH 60 GILRRRQSRA KLEAQNKLIK SRKPYLHESR HRHALNRVRG SGGRFLSAKQ LPQSNAELVT 120 DAYQKKDASE AENHPSSTGE NASITFTAIS ALTSMSSNSV NFPNMAGSSQ CSGGLTFGAG 180 ALQCTSVGR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-24 | 49 | 110 | 2 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.28971 | 0.0 | flower| hypocotyl| root |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.17G051400.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT096576 | 0.0 | BT096576.1 Soybean clone JCVI-FLGm-15L7 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014624790.1 | 1e-140 | nuclear transcription factor Y subunit A-19 isoform X2 | ||||
Refseq | XP_014624791.1 | 1e-140 | nuclear transcription factor Y subunit A-19 isoform X2 | ||||
TrEMBL | A0A0R0F7S6 | 1e-139 | A0A0R0F7S6_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA17G05920.1 | 1e-133 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54160.1 | 1e-38 | nuclear factor Y, subunit A5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.17G051400.2.p |
Entrez Gene | 100777544 |