PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G337500.1.p
Common NameGLYMA_13G337500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 554aa    MW: 62796.6 Da    PI: 5.6841
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G337500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS138.95.3e-432383823153
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cA+av++ d+++a++lL+++++++sp+g+ +qRla+yf ++L+ rla    ++ + +p + ++    ++ l+a+klf+  sP+ +
  Glyma.13G337500.1.p 238 TLLTQCAQAVANYDQRNANELLSQIRQHSSPYGNGLQRLAHYFSNGLQIRLAA---GTPSYMPLEVAT---AADMLKAYKLFVTSSPLQR 321
                          69**************************************************9...333344444444...789**************** PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg 153
                          +++ ++ + I   v++e+ vHiiDf+i +G+QWp+L+++L++R ++ p+lRiTg++ p++g
  Glyma.13G337500.1.p 322 LTNYLTTKSIISLVKNESSVHIIDFGICYGFQWPCLIKKLSDRLGDRPRLRITGIDLPQPG 382
                          ********************************************************99876 PP

2GRAS141.11.2e-43389551212374
                 GRAS 212 rlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                          +l+de+v+++ +rd+vL+l+++++P+++++   +  ++++ Fl+rf eal+++s+lfd +ea++pre+ +r+++E++l+gr++ nv+ace
  Glyma.13G337500.1.p 389 NLPDETVDVKCPRDAVLRLIRRINPNMFIHGVVNGTYSAPFFLTRFREALHHFSSLFDVYEANVPREDTQRVMLEKRLFGRDAINVIACE 478
                          68999************************************************************************************* PP

                 GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                          gaer+er et+++W+ r ++aGF++vpl+ + + +a  ++++ + + + v e++++++lg k+r L ++SaW+
  Glyma.13G337500.1.p 479 GAERVERPETYKQWQVRNQRAGFEQVPLDPQLVVDATDIVKREYHEDFVVAENDKWVLLGRKGRILNAISAWT 551
                          ********************************************899*************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.567210531IPR005202Transcription factor GRAS
PfamPF035141.8E-40238382IPR005202Transcription factor GRAS
PfamPF035144.0E-41389551IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
SSGESMEFTK YSNPILRYIS DILMDEEDDL ERRPCMLQDC LRLQAAEKSF HDVLLHQNPS  60
PFRDESSNGS CTTDNSCESN LVNGVSEFNS SFLQLETPLV DSPDAVPDPP FGESRPIGYF  120
LDGTWNLFQS HTKMVEKGSS ASALREKRNH QMDDYESHEQ EARKGSKVSA VFYDESEPPE  180
ILDEVLLYQT GRSQPLYSSP TVPSQTQRVD LGRSSGKEAR ARSKEVSSNT ETAIDLWTLL  240
TQCAQAVANY DQRNANELLS QIRQHSSPYG NGLQRLAHYF SNGLQIRLAA GTPSYMPLEV  300
ATAADMLKAY KLFVTSSPLQ RLTNYLTTKS IISLVKNESS VHIIDFGICY GFQWPCLIKK  360
LSDRLGDRPR LRITGIDLPQ PGFRPKERNL PDETVDVKCP RDAVLRLIRR INPNMFIHGV  420
VNGTYSAPFF LTRFREALHH FSSLFDVYEA NVPREDTQRV MLEKRLFGRD AINVIACEGA  480
ERVERPETYK QWQVRNQRAG FEQVPLDPQL VVDATDIVKR EYHEDFVVAE NDKWVLLGRK  540
GRILNAISAW TPD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-3724255224379Protein SCARECROW
5b3h_D1e-3724255224379Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.13G337500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025981534.10.0LOW QUALITY PROTEIN: uncharacterized protein LOC100779806
TrEMBLA0A0R0GY580.0A0A0R0GY58_SOYBN; Uncharacterized protein (Fragment)
STRINGGLYMA13G41251.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-123GRAS family protein