PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.13G295400.1.p | ||||||||
Common Name | GLYMA_13G295400, LOC100779599 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 159aa MW: 18296.4 Da PI: 9.1196 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 116.2 | 1.8e-36 | 40 | 109 | 8 | 77 |
----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 8 eadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 +adl eak+yhrrh+vCe h ka+vvlv++++qrfCqqCsrfhel efD++krsCr+ La+hnerrrk++ Glyma.13G295400.1.p 40 NADLHEAKQYHRRHRVCEYHVKAQVVLVDEVRQRFCQQCSRFHELAEFDDTKRSCRSSLAGHNERRRKNS 109 79******************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 26.196 | 31 | 108 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 1.8E-27 | 34 | 95 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.83E-31 | 40 | 111 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.0E-29 | 40 | 107 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MVVRSDRLKR DVADCGDNNQ NGYVEQEKKI KGVHICGVVN ADLHEAKQYH RRHRVCEYHV 60 KAQVVLVDEV RQRFCQQCSR FHELAEFDDT KRSCRSSLAG HNERRRKNSD QSQAEGSSRN 120 KGTGHPQLKD ITCGQADERG RIQITIHENA AYKHFQIR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-28 | 32 | 107 | 7 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.13G295400.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006595445.1 | 1e-113 | squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q9S7A9 | 1e-33 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | I1M3R4 | 1e-112 | I1M3R4_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA13G37130.1 | 1e-113 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 | Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 5e-36 | squamosa promoter binding protein-like 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.13G295400.1.p |
Entrez Gene | 100779599 |