PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.13G256900.1.p | ||||||||
Common Name | GLYMA_13G256900, LOC100818433 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 249aa MW: 28679.3 Da PI: 10.122 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 77.4 | 1e-24 | 51 | 100 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+i++ + rqvtfskR+ g++KKA ELS LCdae+a+i+fs+ gkl++y Glyma.13G256900.1.p 51 KKIDDVTARQVTFSKRKSGLFKKARELSLLCDAEIALIVFSPGGKLFDYG 100 689********************************************995 PP | |||||||
2 | K-box | 44.3 | 7.8e-16 | 129 | 213 | 15 | 99 |
K-box 15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 e+ + ++a L+ke re R+l Ge+L+ L+l+eLq+Le++L++sl+++ + K e ++++i l++k k+l e+n+ ++++++ Glyma.13G256900.1.p 129 EQVRCNYADLNKEFADRTREMRQLNGEELQGLTLRELQKLEERLDSSLNRVYKAKVENFIKEIGILKEKGKKLMEDNMLIKQMIK 213 566678999999999999************************************************************9999875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 7.5E-37 | 43 | 102 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.315 | 43 | 103 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-24 | 45 | 65 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 45 | 99 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.93E-29 | 45 | 121 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.19E-37 | 45 | 111 | No hit | No description |
Pfam | PF00319 | 2.9E-24 | 52 | 99 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-24 | 65 | 80 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-24 | 80 | 101 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.7E-15 | 128 | 212 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.204 | 128 | 218 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MWHIHVFPHT VFSLESKDWA RVAFASAFSI AKESSAFHRN KKMVRRKIPI KKIDDVTARQ 60 VTFSKRKSGL FKKARELSLL CDAEIALIVF SPGGKLFDYG SSSMQKVIER HILRSELNLE 120 KLDQSCPTEQ VRCNYADLNK EFADRTREMR QLNGEELQGL TLRELQKLEE RLDSSLNRVY 180 KAKVENFIKE IGILKEKGKK LMEDNMLIKQ MIKLPRNEIC SVQRHEHEQG QLFDTSLTLG 240 LPFPAGSK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
6byy_B | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
6byy_C | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
6byy_D | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
6bz1_A | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
6bz1_B | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
6bz1_C | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
6bz1_D | 3e-19 | 43 | 116 | 1 | 74 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.9646 | 0.0 | flower| pod |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During vegetative phase expressed in young leaves and apical meristem until early stage of bolting. Early in development of the inflorescence present in the coflorescence and flower primordia but not in the main apical meristem. Present throughout the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. {ECO:0000269|PubMed:19656343}. | |||||
Uniprot | TISSUE SPECIFICITY: Detected in roots and leaves. Expressed at very low levels in flowers and siliques. Present in floral meristems. {ECO:0000269|PubMed:19656343}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.13G256900.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015038 | 1e-60 | AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006594670.1 | 0.0 | MADS-box protein SVP isoform X1 | ||||
Refseq | XP_028188416.1 | 0.0 | MADS-box protein SVP-like isoform X1 | ||||
Swissprot | Q9FUY6 | 6e-53 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
Swissprot | Q9FVC1 | 5e-53 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A0R0GU09 | 0.0 | A0A0R0GU09_SOYBN; Uncharacterized protein | ||||
TrEMBL | A0A445IA32 | 0.0 | A0A445IA32_GLYSO; MADS-box protein SVP isoform A | ||||
STRING | GLYMA13G33031.1 | 1e-166 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF26660 | 2 | 3 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-49 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.13G256900.1.p |
Entrez Gene | 100818433 |