PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.09G254400.1.p | ||||||||
Common Name | GLYMA_09G254400, LOC100796481 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 193aa MW: 21902.7 Da PI: 8.7921 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.7 | 1e-32 | 113 | 171 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+ Glyma.09G254400.1.p 113 LDDGYRWRKYGQKAVKNSTYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 171 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.3E-33 | 100 | 171 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-28 | 106 | 172 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.057 | 108 | 173 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.2E-37 | 113 | 172 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.4E-26 | 114 | 171 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MESQDPPNPP PQNNPFIFTP NSMLQNPNWD PQEQSGLCDI DWGNLFSAQN GLLLNGDAKD 60 AIECASSFSF VAQNKGVCEE EKGNKEKRKG GRMKKTTRVP RFAFQTRSAD DILDDGYRWR 120 KYGQKAVKNS TYPRSYYRCT HHTCNVKKQV QRLSKDTSIV VTTYEGIHNH PCEKLMETLT 180 PLLKQIQFLA SL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-24 | 103 | 170 | 7 | 74 | Probable WRKY transcription factor 4 |
2ayd_A | 1e-24 | 101 | 170 | 2 | 71 | WRKY transcription factor 1 |
2lex_A | 1e-24 | 103 | 170 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.6156 | 0.0 | root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.09G254400.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU019592 | 0.0 | EU019592.1 Glycine max WRKY64 (WRKY64) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003534536.1 | 1e-145 | probable WRKY transcription factor 43 | ||||
Swissprot | Q9FFS3 | 1e-55 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | I1L6F2 | 1e-144 | I1L6F2_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA09G39000.1 | 1e-145 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 4e-56 | WRKY DNA-binding protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.09G254400.1.p |
Entrez Gene | 100796481 |