PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G149000.6.p
Common NameGLYMA_09G149000, LOC100793681
Organism
Glycine max
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MIKC_MADS
Protein Properties Length: 157aa    MW: 18322.9 Da    PI: 10.1243
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G149000.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.71.7e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         +rienk+nrqvtfskRr g+lKKA+ELSvLCdaev +iifss+gkl+ yss
  Glyma.09G149000.6.p  9 ERIENKINRQVTFSKRRSGLLKKAFELSVLCDAEVGLIIFSSRGKLFQYSS 59
                         69***********************************************96 PP
2K-box661.3e-2276156383
                K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                          ks++ +  e++++s ++e+ kL++++e+L+r+qRh++GedLe+Ls+k+Lq+Le+qL+  l   R+++++ l++  +el++k
  Glyma.09G149000.6.p  76 KSHTGDSLEHDSQSAYHEFLKLRAKYESLERTQRHFQGEDLEPLSFKDLQSLEKQLDITLALTRQHQTKKLMARADELREK 156
                          555555778889******************************************************************987 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.202161IPR002100Transcription factor, MADS-box
SMARTSM004327.6E-38160IPR002100Transcription factor, MADS-box
CDDcd002652.64E-39275No hitNo description
SuperFamilySSF554551.83E-31276IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.0E-1884156IPR002487Transcription factor, K-box
PROSITE profilePS5129711.98387156IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGRGRVVLER IENKINRQVT FSKRRSGLLK KAFELSVLCD AEVGLIIFSS RGKLFQYSST  60
DITKIIERYR QCRYSKSHTG DSLEHDSQSA YHEFLKLRAK YESLERTQRH FQGEDLEPLS  120
FKDLQSLEKQ LDITLALTRQ HQTKKLMARA DELREK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-25178176MEF2 CHIMERA
6byy_B4e-25178176MEF2 CHIMERA
6byy_C4e-25178176MEF2 CHIMERA
6byy_D4e-25178176MEF2 CHIMERA
6bz1_A5e-25178176MEF2 CHIMERA
6bz1_B5e-25178176MEF2 CHIMERA
6bz1_C5e-25178176MEF2 CHIMERA
6bz1_D5e-25178176MEF2 CHIMERA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.169740.0flower
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development in the inner and outer integuments. Not detected in young panicles. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:19820190}.
UniprotTISSUE SPECIFICITY: Expressed in the floral meristem. Highly expressed in lodicules. Expressed in palea and pistil. Weakly expressed in carpels, empty glumes and stamens. Not detected in lemmas. {ECO:0000269|PubMed:10444103, ECO:0000269|PubMed:19820190}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.09G149000.6.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0936810.0BT093681.1 Soybean clone JCVI-FLGm-14A18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587366.11e-110truncated transcription factor CAULIFLOWER D isoform X2
RefseqXP_028179811.11e-110truncated transcription factor CAULIFLOWER D-like isoform X2
SwissprotQ6EU392e-65MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLA0A445J1431e-109A0A445J143_GLYSO; MADS-box transcription factor 6 isoform A
TrEMBLK7LE091e-109K7LE09_SOYBN; Uncharacterized protein
STRINGGLYMA09G27461.11e-109(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-58AGAMOUS-like 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Li H, et al.
    The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice.
    Cell Res., 2010. 20(3): p. 299-313
    [PMID:20038961]
  3. Zhang J,Nallamilli BR,Mujahid H,Peng Z
    OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa).
    Plant J., 2010. 64(4): p. 604-17
    [PMID:20822505]
  4. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  5. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  6. Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U
    Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility.
    Plant Cell Physiol., 2011. 52(12): p. 2123-35
    [PMID:22016342]
  7. Duan Y, et al.
    Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
    Plant Mol. Biol., 2012. 80(4-5): p. 429-42
    [PMID:22933119]
  8. Conrad LJ, et al.
    The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice.
    Plant J., 2014. 80(5): p. 883-94
    [PMID:25279942]
  9. Zhang J, et al.
    Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice.
    J. Exp. Bot., 2015. 66(1): p. 99-112
    [PMID:25324400]
  10. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]
  11. Zhang B, et al.
    A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.).
    PLoS Genet., 2016. 12(7): p. e1006152
    [PMID:27367609]