PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.09G149000.6.p | ||||||||
Common Name | GLYMA_09G149000, LOC100793681 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 157aa MW: 18322.9 Da PI: 10.1243 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.7 | 1.7e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +rienk+nrqvtfskRr g+lKKA+ELSvLCdaev +iifss+gkl+ yss Glyma.09G149000.6.p 9 ERIENKINRQVTFSKRRSGLLKKAFELSVLCDAEVGLIIFSSRGKLFQYSS 59 69***********************************************96 PP | |||||||
2 | K-box | 66 | 1.3e-22 | 76 | 156 | 3 | 83 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 ks++ + e++++s ++e+ kL++++e+L+r+qRh++GedLe+Ls+k+Lq+Le+qL+ l R+++++ l++ +el++k Glyma.09G149000.6.p 76 KSHTGDSLEHDSQSAYHEFLKLRAKYESLERTQRHFQGEDLEPLSFKDLQSLEKQLDITLALTRQHQTKKLMARADELREK 156 555555778889******************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.202 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.6E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.64E-39 | 2 | 75 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-31 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.0E-18 | 84 | 156 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.983 | 87 | 156 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MGRGRVVLER IENKINRQVT FSKRRSGLLK KAFELSVLCD AEVGLIIFSS RGKLFQYSST 60 DITKIIERYR QCRYSKSHTG DSLEHDSQSA YHEFLKLRAK YESLERTQRH FQGEDLEPLS 120 FKDLQSLEKQ LDITLALTRQ HQTKKLMARA DELREK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 4e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
6byy_B | 4e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
6byy_C | 4e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
6byy_D | 4e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
6bz1_A | 5e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
6bz1_B | 5e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
6bz1_C | 5e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
6bz1_D | 5e-25 | 1 | 78 | 1 | 76 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.16974 | 0.0 | flower |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development in the inner and outer integuments. Not detected in young panicles. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:19820190}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the floral meristem. Highly expressed in lodicules. Expressed in palea and pistil. Weakly expressed in carpels, empty glumes and stamens. Not detected in lemmas. {ECO:0000269|PubMed:10444103, ECO:0000269|PubMed:19820190}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.09G149000.6.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT093681 | 0.0 | BT093681.1 Soybean clone JCVI-FLGm-14A18 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006587366.1 | 1e-110 | truncated transcription factor CAULIFLOWER D isoform X2 | ||||
Refseq | XP_028179811.1 | 1e-110 | truncated transcription factor CAULIFLOWER D-like isoform X2 | ||||
Swissprot | Q6EU39 | 2e-65 | MADS6_ORYSJ; MADS-box transcription factor 6 | ||||
TrEMBL | A0A445J143 | 1e-109 | A0A445J143_GLYSO; MADS-box transcription factor 6 isoform A | ||||
TrEMBL | K7LE09 | 1e-109 | K7LE09_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA09G27461.1 | 1e-109 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-58 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.09G149000.6.p |
Entrez Gene | 100793681 |