![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.06G038200.1.p | ||||||||
Common Name | GLYMA_06G038200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 89aa MW: 10251 Da PI: 9.1187 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 41.1 | 3.9e-13 | 1 | 53 | 24 | 76 |
NF-YC 24 arikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkk 76 arikki++adedv +i+ +Pvl+ska elf+ +l r++ + + +t++ Glyma.06G038200.1.p 1 ARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNS 53 7***************************************9999888888875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 2.2E-16 | 1 | 57 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 1.7E-21 | 1 | 57 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.29E-12 | 7 | 58 | IPR009072 | Histone-fold |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
ARIKKIMQAD EDVGKIALAV PVLVSKALEL FLQDLCDRTY EITLQRGAKT MNSLHLNSET 60 IYNGFPIIRE RIKDLQDFQP NWLIMYRK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_A | 4e-18 | 1 | 66 | 15 | 80 | Transcription Regulator NC2 alpha chain |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.06G038200.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT094155 | 9e-90 | BT094155.1 Soybean clone JCVI-FLGm-18C10 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018733368.1 | 3e-33 | PREDICTED: dr1-associated corepressor | ||||
Refseq | XP_028192968.1 | 5e-34 | dr1-associated corepressor-like | ||||
Refseq | XP_028192969.1 | 5e-34 | dr1-associated corepressor-like | ||||
Swissprot | Q14919 | 2e-16 | NC2A_HUMAN; Dr1-associated corepressor | ||||
TrEMBL | A0A0R0JBL0 | 8e-59 | A0A0R0JBL0_SOYBN; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A445HQF4 | 8e-59 | A0A445HQF4_GLYSO; Dr1-associated corepressor (Fragment) | ||||
STRING | GLYMA06G04161.1 | 6e-33 | (Glycine max) | ||||
STRING | XP_010067677.1 | 9e-33 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1728 | 34 | 91 | Representative plant | OGRP2179 | 16 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12480.1 | 5e-33 | nuclear factor Y, subunit C11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.06G038200.1.p |