PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.04G159300.1.p | ||||||||
Common Name | GLYMA_04G159300, LOC100784742 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 245aa MW: 27999.9 Da PI: 9.7198 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.2 | 5.1e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+Sv Cdaeva+i+fs++gkl+eyss Glyma.04G159300.1.p 9 KRIENKINRQVTFSKRRSGLLKKAHEISVHCDAEVALIVFSTKGKLFEYSS 59 79***********************************************96 PP | |||||||
2 | K-box | 104.1 | 1.7e-34 | 77 | 174 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 +++ ++ ++ +e+++ e+akLk+++e Lq++qR+++G+dLe Ls+keLq+Le+qLe++lk+iRs+Kn+l++e+i+el kk k+lqe+n+ Glyma.04G159300.1.p 77 ERQLVASDQPLTENWTLEHAKLKARLEVLQKNQRNFMGQDLEGLSIKELQNLEHQLESALKHIRSRKNQLMYESISELHKKDKALQEQNN 166 566666777789****************************************************************************** PP K-box 93 aLrkklee 100 +L kk++e Glyma.04G159300.1.p 167 TLAKKIKE 174 *****987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.3E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.258 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.31E-33 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.75E-42 | 2 | 79 | No hit | No description |
PRINTS | PR00404 | 5.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.1E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.1E-29 | 87 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.013 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVHCD AEVALIVFST KGKLFEYSSD 60 PCMEKILERY ERYSYAERQL VASDQPLTEN WTLEHAKLKA RLEVLQKNQR NFMGQDLEGL 120 SIKELQNLEH QLESALKHIR SRKNQLMYES ISELHKKDKA LQEQNNTLAK KIKEKEKALA 180 QQAQLERLGD EVDLTSSALV PQPLVTSNIR TSSQIRGEGD NEGTPTPTQA NAILPPWMLR 240 PTNE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 6e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 7e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.1882 | 0.0 | pod |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Vascular tissue of cauline leaves, floral shoot apex and valves of carpels and fruits. {ECO:0000269|PubMed:9502732}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.04G159300.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU287456 | 0.0 | EU287456.1 Glycine max MADS box protein AP1a (AP1a) mRNA, complete cds. | |||
GenBank | KF831241 | 0.0 | KF831241.1 Glycine max FULa mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003522984.1 | 0.0 | truncated transcription factor CAULIFLOWER A isoform X4 | ||||
Swissprot | Q38876 | 1e-114 | AGL8_ARATH; Agamous-like MADS-box protein AGL8 | ||||
TrEMBL | K7KKE4 | 1e-180 | K7KKE4_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA04G31847.1 | 1e-180 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF588 | 32 | 119 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 1e-107 | AGAMOUS-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.04G159300.1.p |
Entrez Gene | 100784742 |