PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.02G041500.3.p | ||||||||
Common Name | GLYMA_02G041500, SVP | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 204aa MW: 23169.5 Da PI: 8.0852 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.2 | 2.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKAeELSv+Cda+va+iifsstgkl+eyss Glyma.02G041500.3.p 9 KKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 50.4 | 9.6e-18 | 93 | 170 | 20 | 97 |
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 + ++L ke+ + +++R+l GedL+ L+++eLqqLe+ Le++l ++ +kK e ++++i +lq+k l een++L++ Glyma.02G041500.3.p 93 NCSRLSKEVAEKSHQLRQLRGEDLQGLNIEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLKRH 170 568899999999999************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.829 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.35E-39 | 3 | 77 | No hit | No description |
PRINTS | PR00404 | 4.2E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-31 | 3 | 81 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.2E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.853 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.6E-16 | 92 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MVREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVMCD ADVALIIFSS TGKLFEYSSS 60 SMKEILERHH LHSKNLARME QPSLELQLVE NSNCSRLSKE VAEKSHQLRQ LRGEDLQGLN 120 IEELQQLERS LETGLGRVIE KKGEKIMSEI TDLQRKGMLL MEENERLKRH SSESVTYVCN 180 STGPPQDFES SDTSLKLGLP YSG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.18530 | 0.0 | cotyledon| hypocotyl| leaf| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During vegetative phase expressed in young leaves and apical meristem until early stage of bolting. Early in development of the inflorescence present in the coflorescence and flower primordia but not in the main apical meristem. Present throughout the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. {ECO:0000269|PubMed:19656343}. | |||||
Uniprot | TISSUE SPECIFICITY: Detected in roots and leaves. Expressed at very low levels in flowers and siliques. Present in floral meristems. {ECO:0000269|PubMed:19656343}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.02G041500.3.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU256477 | 0.0 | EU256477.1 Glycine max short vegetative phase-like protein (SVPL) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006574410.1 | 1e-146 | MADS-box protein SVP-like isoform X2 | ||||
Refseq | XP_028195919.1 | 1e-146 | MADS-box protein JOINTLESS-like isoform X2 | ||||
Swissprot | Q9FVC1 | 1e-105 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | I1JCA3 | 1e-145 | I1JCA3_SOYBN; MADS-box short vegitative phase | ||||
STRING | GLYMA02G04710.1 | 1e-140 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-107 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.02G041500.3.p |