PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.01G069300.1.p | ||||||||
Common Name | bZIP35, GLYMA_01G069300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 199aa MW: 22668.6 Da PI: 5.9753 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.8 | 3.1e-15 | 83 | 141 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ rr+++NRe+ArrsR RK++ ++eL v L +eN+ L+++l++ ++ +++ +e+ Glyma.01G069300.1.p 83 RKHRRMISNRESARRSRMRKQKHLDELWSQVVRLRTENHNLIDKLNHVSESHDRVLQEN 141 688*********************************************99999888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.0E-14 | 79 | 143 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.737 | 81 | 144 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.6E-13 | 83 | 141 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.85E-13 | 83 | 133 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.6E-12 | 83 | 156 | No hit | No description |
CDD | cd14702 | 4.82E-21 | 84 | 135 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 86 | 101 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MVPSEIRGVH YLAPENPFLV PPNFSLLQSD IPNLHLNTLL SNFPNCHFPP SGHEFVVPPS 60 SCLSSNSTSD EADEIQFNII DERKHRRMIS NRESARRSRM RKQKHLDELW SQVVRLRTEN 120 HNLIDKLNHV SESHDRVLQE NARLKEEASA LRQMLADMQI GTAFACTMED LEDLPCNTSQ 180 LKPDPLNQSI TPADMIHE* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 95 | 102 | RRSRMRKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.28646 | 0.0 | cotyledon| leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.01G069300.1.p |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF350505 | 0.0 | AF350505.1 Phaseolus vulgaris bZip transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001236950.1 | 1e-145 | bZIP transcription factor bZIP35 | ||||
Refseq | XP_028232452.1 | 1e-145 | basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 1e-36 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A0B2R968 | 1e-143 | A0A0B2R968_GLYSO; Basic leucine zipper 43 | ||||
TrEMBL | Q0GPI4 | 1e-143 | Q0GPI4_SOYBN; BZIP transcription factor bZIP35 | ||||
STRING | GLYMA01G09510.1 | 1e-144 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1604 | 33 | 99 | Representative plant | OGRP3104 | 11 | 29 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 1e-46 | basic leucine-zipper 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.01G069300.1.p |
Entrez Gene | 778126 |
Publications ? help Back to Top | |||
---|---|---|---|
|