PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca140422G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 78aa MW: 9297.65 Da PI: 11.2548

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca140422G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	105.8	5.6e-33	2	72	57	128
NAM 57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ewyf+s+rdkky++g+r+nrat+ gyWkatgkd++v s ++++vg+kktLv+y+grap+g +t+Wvmheyrl Gh_Sca140422G01 2 EWYFYSPRDKKYPNGSRTNRATRGGYWKATGKDRTVQS-QKRAVGIKKTLVYYRGRAPHGIRTNWVMHEYRL 72 8**********************************9.9999*************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	36.017	1	78	IPR003441	NAC domain
SuperFamily	SSF101941	4.71E-34	2	75	IPR003441	NAC domain
Pfam	PF02365	3.8E-16	3	72	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MEWYFYSPRD KKYPNGSRTN RATRGGYWKA TGKDRTVQSQ KRAVGIKKTL VYYRGRAPHG 60 IRTNWVMHEY RLLNSTLK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	8e-32	2	76	72	146	NO APICAL MERISTEM PROTEIN
1ut4_B	8e-32	2	76	72	146	NO APICAL MERISTEM PROTEIN
1ut7_A	8e-32	2	76	72	146	NO APICAL MERISTEM PROTEIN
1ut7_B	8e-32	2	76	72	146	NO APICAL MERISTEM PROTEIN
3swm_A	9e-32	2	76	75	149	NAC domain-containing protein 19
3swm_B	9e-32	2	76	75	149	NAC domain-containing protein 19
3swm_C	9e-32	2	76	75	149	NAC domain-containing protein 19
3swm_D	9e-32	2	76	75	149	NAC domain-containing protein 19
3swp_A	9e-32	2	76	75	149	NAC domain-containing protein 19
3swp_B	9e-32	2	76	75	149	NAC domain-containing protein 19
3swp_C	9e-32	2	76	75	149	NAC domain-containing protein 19
3swp_D	9e-32	2	76	75	149	NAC domain-containing protein 19
4dul_A	8e-32	2	76	72	146	NAC domain-containing protein 19
4dul_B	8e-32	2	76	72	146	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269\|PubMed:25081480}.
Uniprot	TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269\|PubMed:25081480}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269\|PubMed:25081480}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016692076.1	2e-51	PREDICTED: NAC domain-containing protein 86-like
Refseq	XP_016714972.1	2e-51	PREDICTED: NAC domain-containing protein 86-like
Swissprot	A4VCM0	3e-39	NAC45_ARATH; NAC domain-containing protein 45
Swissprot	Q9FFI5	3e-39	NAC86_ARATH; NAC domain-containing protein 86
TrEMBL	A0A1U8JP71	5e-50	A0A1U8JP71_GOSHI; NAC domain-containing protein 86-like
TrEMBL	A0A1U8LK66	4e-50	A0A1U8LK66_GOSHI; NAC domain-containing protein 86-like
STRING	Gorai.004G268400.1	3e-50	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM21958	4	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G17260.1	1e-41	NAC domain containing protein 86

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]