PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca121194G01

Common Name

NAP, SNAC1

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 58aa MW: 6591.66 Da PI: 10.7463

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca121194G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	52.9	1.3e-16	1	43	85	128
NAM 85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 atg+dk+++s +++ vg+kk Lvfykg+ pkg ktdW+mheyrl Gh_Sca121194G01 1 ATGTDKAIYS-GSKYVGVKKALVFYKGKPPKGLKTDWIMHEYRL 43 69******.999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.03E-17	1	48	IPR003441	NAC domain
PROSITE profile	PS51005	20.281	1	58	IPR003441	NAC domain
Pfam	PF02365	9.2E-7	11	43	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 58 aa Download sequence Send to blast
ATGTDKAIYS GSKYVGVKKA LVFYKGKPPK GLKTDWIMHE YRLNDSRKQI TKQNGSMR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	7e-15	1	58	100	153	NO APICAL MERISTEM PROTEIN
1ut4_B	7e-15	1	58	100	153	NO APICAL MERISTEM PROTEIN
1ut7_A	7e-15	1	58	100	153	NO APICAL MERISTEM PROTEIN
1ut7_B	7e-15	1	58	100	153	NO APICAL MERISTEM PROTEIN
3swm_A	8e-15	1	58	103	156	NAC domain-containing protein 19
3swm_B	8e-15	1	58	103	156	NAC domain-containing protein 19
3swm_C	8e-15	1	58	103	156	NAC domain-containing protein 19
3swm_D	8e-15	1	58	103	156	NAC domain-containing protein 19
3swp_A	8e-15	1	58	103	156	NAC domain-containing protein 19
3swp_B	8e-15	1	58	103	156	NAC domain-containing protein 19
3swp_C	8e-15	1	58	103	156	NAC domain-containing protein 19
3swp_D	8e-15	1	58	103	156	NAC domain-containing protein 19
4dul_A	7e-15	1	58	100	153	NAC domain-containing protein 19
4dul_B	7e-15	1	58	100	153	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.19022	2e-65	boll\| leaf

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269\|PubMed:29760199}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269\|PubMed:29760199}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269\|PubMed:29760199}.
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269\|PubMed:29760199}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269\|PubMed:29760199}.
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269\|PubMed:29760199}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ914140	1e-87	JQ914140.1 Gossypium hirsutum NAC domain protein 9 (NAC9) mRNA, complete cds.
GenBank	KP203895	1e-87	KP203895.1 Gossypium hirsutum putative NAC transcription factor (SNAC1) mRNA, complete cds.
GenBank	KP300008	1e-87	KP300008.1 Gossypium hirsutum cultivar CCRI10 NAP (NAP) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001313668.1	5e-34	NAC transcription factor 29-like
Refseq	XP_012478708.1	5e-34	PREDICTED: NAC transcription factor 29-like
Refseq	XP_016693352.1	5e-34	PREDICTED: NAC transcription factor 29-like
Refseq	XP_017640689.1	5e-34	PREDICTED: NAC transcription factor 29-like
Swissprot	K4BNG7	4e-29	NAP2_SOLLC; NAC domain-containing protein 2
Swissprot	K4BWV2	5e-29	NAP1_SOLLC; NAC domain-containing protein 1
TrEMBL	A0A0D2SGT9	1e-32	A0A0D2SGT9_GOSRA; Uncharacterized protein
TrEMBL	A0A0E3M078	1e-32	A0A0E3M078_GOSHI; NAC transcription factor 29-like
TrEMBL	A0A1U8JSV9	1e-32	A0A1U8JSV9_GOSHI; NAC transcription factor 29-like
TrEMBL	A0A2P5QYI2	1e-32	A0A2P5QYI2_GOSBA; Uncharacterized protein
TrEMBL	U5IJG3	1e-32	U5IJG3_GOSHI; NAC domain protein 9
STRING	Gorai.005G142300.1	2e-33	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM190	28	276

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	6e-31	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Ma X, et al. The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato. Plant Physiol., 2018. 177(3): p. 1286-1302 [PMID:29760199]