PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D07G0177 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 173aa MW: 19948.4 Da PI: 5.1092 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 98.3 | 4.8e-31 | 112 | 170 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YY+C +gCpvkk+ver+ edp++v++tYeg Hnh+ Gh_D07G0177 112 LDDGYRWRKYGKKMVKNSPNPRNYYKCLIEGCPVKKRVERDGEDPSYVITTYEGIHNHQ 170 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.3E-33 | 98 | 171 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.92E-28 | 105 | 170 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.953 | 107 | 172 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.5E-35 | 112 | 171 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.4E-24 | 113 | 170 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MHILLFSFII EMFNNKFGLP NSPESGCAGR TKFEFPDAYF DGWLHEGYRG AMISGTIENP 60 FNQANELFDE FACNGSLLIP APDDNRESET VGEMSEFKER YAFKTKSEIE ILDDGYRWRK 120 YGKKMVKNSP NPRNYYKCLI EGCPVKKRVE RDGEDPSYVI TTYEGIHNHQ SVS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 9e-27 | 102 | 169 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 9e-27 | 102 | 169 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.132 | 0.0 | boll |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF669805 | 0.0 | KF669805.1 Gossypium hirsutum WRKY transcription factor 114 (WRKY114) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012489455.1 | 1e-128 | PREDICTED: probable WRKY transcription factor 50 isoform X1 | ||||
Refseq | XP_016744828.1 | 1e-128 | PREDICTED: probable WRKY transcription factor 50 isoform X1 | ||||
TrEMBL | A0A0D2PSV2 | 1e-127 | A0A0D2PSV2_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8P3A6 | 1e-127 | A0A1U8P3A6_GOSHI; probable WRKY transcription factor 50 isoform X1 | ||||
STRING | Gorai.001G021500.1 | 1e-127 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 3e-42 | WRKY DNA-binding protein 50 |