PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D06G2328 | ||||||||
Common Name | WRKY38 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 157aa MW: 18421.1 Da PI: 4.8098 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99 | 3e-31 | 96 | 154 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K vk+s++pr+YYrC+ gCpvkk+ver++edp++v++tYeg Hnh+ Gh_D06G2328 96 LDDGYRWRKYGKKWVKNSPNPRNYYRCSIDGCPVKKRVERDKEDPSYVITTYEGIHNHR 154 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.0E-34 | 83 | 155 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.1E-28 | 89 | 154 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.918 | 91 | 156 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.3E-35 | 96 | 155 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.5E-25 | 97 | 154 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MSSSNFNPPD SPESDRADQS NFEFPEDWTL DGWLEDYPET IITGPIQFPF NQADEVNNDS 60 ARTSSLLQVS ENETARERRD VRERFAFKTK SEVEILDDGY RWRKYGKKWV KNSPNPRNYY 120 RCSIDGCPVK KRVERDKEDP SYVITTYEGI HNHRSVS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-26 | 86 | 153 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-26 | 86 | 153 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.16248 | 1e-105 | leaf| ovule |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF031085 | 0.0 | KF031085.1 Gossypium hirsutum WRKY transcription factor 38 (WRKY38) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012449571.1 | 1e-114 | PREDICTED: probable WRKY transcription factor 50 | ||||
Refseq | XP_016699617.1 | 1e-114 | PREDICTED: probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 4e-43 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A059Q7A1 | 1e-112 | A0A059Q7A1_GOSHI; WRKY transcription factor 38 | ||||
TrEMBL | A0A0D2SQE6 | 1e-112 | A0A0D2SQE6_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.010G098000.1 | 1e-113 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-45 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|