PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_D06G0115

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 155aa MW: 17163.2 Da PI: 9.8901

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_D06G0115	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.2	3.8e-18	22	67	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd l ++v+++G ++W++I+r++ gR++k+c++rw + Gh_D06G0115 22 KGPWSAEEDRVLTRLVERYGARNWSLISRYIK-GRSGKSCRLRWCNQ 67 79***************************9.*********985 PP
2	Myb_DNA-binding	49.4	1.1e-15	76	118	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+ Ede ++ a+ +G++ W+tIa ++ gRt++ +k++w++ Gh_D06G0115 76 PFTKAEDETILAAHGVYGNR-WATIAMLLP-GRTDNAVKNHWNST 118 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.131	17	72	IPR017930	Myb domain
SuperFamily	SSF46689	2.01E-31	19	115	IPR009057	Homeodomain-like
SMART	SM00717	1.2E-15	21	70	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.4E-25	23	75	IPR009057	Homeodomain-like
CDD	cd00167	4.47E-14	24	66	No hit	No description
Pfam	PF13921	2.4E-17	25	83	No hit	No description
SMART	SM00717	6.3E-14	73	121	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	20.166	74	123	IPR017930	Myb domain
CDD	cd00167	1.92E-10	76	119	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.3E-22	76	122	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 155 aa Download sequence Send to blast
MNGCSSSTSS SDTSSSESSR IKGPWSAEED RVLTRLVERY GARNWSLISR YIKGRSGKSC 60 RLRWCNQLSP DVEHRPFTKA EDETILAAHG VYGNRWATIA MLLPGRTDNA VKNHWNSTLK 120 RRAREQKKEQ KGSVVVDEEE VLTALTLAPP GSGGG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-42	21	123	6	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269\|PubMed:9678577}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:9678577}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012450372.1	1e-111	PREDICTED: transcription factor MYB44-like
Swissprot	Q9FDW1	4e-54	MYB44_ARATH; Transcription factor MYB44
TrEMBL	A0A0D2R0I6	1e-109	A0A0D2R0I6_GOSRA; Uncharacterized protein
STRING	Gorai.010G016800.1	1e-110	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM14553	11	22

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G50060.1	2e-53	myb domain protein 77

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]