PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D05G1913 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 244aa MW: 27551.7 Da PI: 8.9368 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59 | 1e-18 | 35 | 80 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd +l ++v+++G+++W++I+r++ gR++k+c++rw + Gh_D05G1913 35 KGPWSAEEDRILTRLVERYGPRNWSLISRYIK-GRSGKSCRLRWCNQ 80 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 52.9 | 8.5e-17 | 89 | 131 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++ Ed+ ++ a++++G++ W+tIar ++ gRt++ +k++w++ Gh_D05G1913 89 PFSQAEDDTILAAHARYGNR-WATIARLLP-GRTDNAVKNHWNST 131 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.289 | 30 | 85 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.69E-31 | 33 | 128 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-17 | 34 | 83 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.5E-18 | 35 | 80 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 36 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.78E-15 | 37 | 79 | No hit | No description |
SMART | SM00717 | 1.0E-14 | 86 | 134 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.247 | 87 | 136 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-22 | 89 | 135 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.21E-10 | 89 | 132 | No hit | No description |
Pfam | PF00249 | 5.2E-14 | 89 | 131 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MEAVNGCSSS TSSSDASSSD SYLSARGSNK AEKIKGPWSA EEDRILTRLV ERYGPRNWSL 60 ISRYIKGRSG KSCRLRWCNQ LSPNVEHRPF SQAEDDTILA AHARYGNRWA TIARLLPGRT 120 DNAVKNHWNS TLKRRAREGQ HHHQQQQQQE HQQRILRVTH QPMDGGDHCA LGSTELMIEE 180 EALTALTLAP PGSGVSSRSA VVVAERRREE RVPAEFWDVM RDVIAREVRE YMSSMLSAET 240 SAFH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 8e-42 | 32 | 136 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.10620 | 7e-38 | boll| ovule| root| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | GQ394167 | 1e-133 | GQ394167.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS1132 SSR marker CGR6715 genomic sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016729603.1 | 0.0 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | Q9SN12 | 5e-57 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A1U8MVP4 | 1e-180 | A0A1U8MVP4_GOSHI; transcription factor MYB44-like | ||||
STRING | Gorai.009G208900.1 | 1e-179 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14553 | 11 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 8e-58 | myb domain protein 73 |
Publications ? help Back to Top | |||
---|---|---|---|
|