PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G0739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 272aa    MW: 30254.9 Da    PI: 5.2991
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G0739genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.71.3e-186861898
        NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++++P arikki++aded+ +i+  +P l+ska elf+ +l  r++  +  +  +t++ s ++++v+  ++fdfl +iv +
  Gh_D05G0739  6 DTRFPAARIKKIMQADEDIGKIAMAVPLLVSKALELFLQDLCDRTYEITMMKGAKTINSSHLKQCVQGFNVFDFLREIVGK 86
                 5789************************************************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471139.6E-21388IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.5E-26372IPR009072Histone-fold
PfamPF008083.2E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MKRKLDTRFP AARIKKIMQA DEDIGKIAMA VPLLVSKALE LFLQDLCDRT YEITMMKGAK  60
TINSSHLKQC VQGFNVFDFL REIVGKVPDL GGLDAATEDC HVPKKRKVAD DDESKKSRMD  120
ESCHVTSSSR GRGRGRGRGQ GRGRQTAGRE TAAHCGKFED DPNISYFEEK HALSLERHVP  180
DDAVESDESK KHNHAGKNIK TPVRNIDLNA DLDENGDLIT SIAAASPRTD DIPENREEYP  240
GWSLCEIEKM AIDPIKLADS NGGIDDEDYD EV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133142RGRGRGQGRG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016689318.10.0PREDICTED: dr1-associated corepressor homolog
TrEMBLA0A1U8JKW30.0A0A1U8JKW3_GOSHI; dr1-associated corepressor homolog
STRINGGorai.009G077100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139682124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.17e-60NF-YC family protein