PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G0158
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 304aa    MW: 33278.9 Da    PI: 5.1877
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G0158genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.91.1e-186861898
        NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++ ++fdfl +iv r
  Gh_D04G0158  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNSLHLKHCVQSYNVFDFLREIVSR 86
                 5789*************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.4E-26372IPR009072Histone-fold
SuperFamilySSF471133.28E-20496IPR009072Histone-fold
PfamPF008082.4E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK  60
TMNSLHLKHC VQSYNVFDFL REIVSRVPDY GHGHGHSDAV AAAAADDDRS ISRRRKAAGD  120
EVHDSDEESK RSRIHDVGHV GTIGRGRGRG RGRGRGRGGR NVERDAHREI EPEPCATLQQ  180
NSKSHPTPGM VVDDGSESKE PIKENTIAED ANQAVRNFDL NAEVDENVEA KPTVGAATAA  240
ALEPATAAAA AAQPSSAEPI TETKHEEYPG WSLSDMDKMA IDPLQLAQLG KRLDEDEEDY  300
DEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-20272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146156RGRGRGRGRGR
2148157RGRGRGRGRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.30050.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9644481e-124JX964448.1 Gossypium hirsutum clone NBRI_TRANS-717 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016714188.10.0PREDICTED: dr1-associated corepressor homolog
TrEMBLA0A1U8LL520.0A0A1U8LL52_GOSHI; dr1-associated corepressor homolog
STRINGGorai.012G022300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.13e-68nuclear factor Y, subunit C11