PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D03G1275 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 203aa MW: 23123.4 Da PI: 9.1133 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 64.6 | 1.4e-20 | 7 | 66 | 3 | 57 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 +R+++t+eq+ +Lee++++ ++p+a+++++++++l +++ ++V++WFqN++a+e++ Gh_D03G1275 7 SRWCPTPEQVMILEEMYRSgVKTPNATQIQQITSHLsfygKIEGKNVFYWFQNHKARERQ 66 7*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 120.3 | 8.1e-39 | 6 | 67 | 3 | 64 |
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 ++RW+PtpeQ++iLee+y+sG++tPn+ +iq+it++L+ yGkie+kNVfyWFQN+kaRerqk Gh_D03G1275 6 SSRWCPTPEQVMILEEMYRSGVKTPNATQIQQITSHLSFYGKIEGKNVFYWFQNHKARERQK 67 79***********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00389 | 2.6E-4 | 4 | 71 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.75E-11 | 7 | 66 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 2.9E-18 | 7 | 66 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 5.9E-8 | 7 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 4.85E-5 | 8 | 67 | No hit | No description |
PROSITE profile | PS50071 | 10.042 | 12 | 67 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MCPAGSSRWC PTPEQVMILE EMYRSGVKTP NATQIQQITS HLSFYGKIEG KNVFYWFQNH 60 KARERQKLRR KLTKQLQLQQ QQLFHHYFDS LPSPPFQHLS YYNSPPPFPQ QVGVHDAAAA 120 AKQGINYTWK LDVSERMDVD KSMMKMYGGD LLMMVDLSTP SLSSPCFFTT ATATTGPPPL 180 KTLELFPVTA SNLKEECNKN NNG |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First expressed in the L1 cells of the lateral regions of a flower primordium at early stage 1, in which the lateral sepals are expected to develop at a later stage. It then rapidly decreases at the late stage 1 and disappears at stage 2. At stage 3, it reappears in all four-sepal young primordia. Not detected at the central zone of the inflorescence meristem and the floral meristem. In stages 4 through 6, when four sepals develop to enclose the flower bud, it is localized at the lateral edges of the four sepals and forms an arch of the L1 cells at the margin of sepals. Expressed in the young primordia of petals and stamens. As the petals and stamens develop, it is limited at the margins of petals and stamens in a way similar to that of sepals. In the vegetative phase, it is expressed at the lateral regions of young leaf primordia, as well as in flowers and floral organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:14711878}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in aerial parts of seedlings, inflorescences and flowers at low level. Expressed in a restricted number of L1 cells at the lateral regions of flower primordia. {ECO:0000269|PubMed:11751640}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor required to initiate organ founder cells in a lateral domain of shoot meristems. Involved in the lateral sepal axis-dependent development of flowers, probably by regulating the proliferation of L1 cells at the lateral region of flower primordia. Required for the formation of the margin cells of the first and second whorl organs. {ECO:0000269|PubMed:11751640, ECO:0000269|PubMed:15169755}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016741295.1 | 1e-153 | PREDICTED: WUSCHEL-related homeobox 3-like | ||||
Swissprot | Q9SIB4 | 8e-45 | WOX3_ARATH; WUSCHEL-related homeobox 3 | ||||
TrEMBL | A0A1U8NR23 | 1e-152 | A0A1U8NR23_GOSHI; WUSCHEL-related homeobox 3-like | ||||
STRING | Gorai.003G138900.1 | 1e-134 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7480 | 26 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28610.1 | 2e-38 | WOX family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|