PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A10G1445 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 106aa MW: 12120.4 Da PI: 10.5438 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 42.6 | 8e-14 | 11 | 50 | 3 | 42 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 i n+s r+ t+ +R +g+ KK +E+S+LC+++ + i++s+ Gh_A10G1445 11 ITNNSARKATYKNRMKGLTKKMSEMSTLCGVDTCAIMYSP 50 89*************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 14.283 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 8.7E-15 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.09E-21 | 1 | 85 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 2.66E-24 | 2 | 85 | No hit | No description |
Pfam | PF00319 | 3.9E-15 | 11 | 52 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MTRKKVKLTY ITNNSARKAT YKNRMKGLTK KMSEMSTLCG VDTCAIMYSP YKSPPEVWPS 60 PMGVQQVLSK LETIPEMEKS KNMLNQKTFL SQKITKAAEQ LKNHCK |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016740176.1 | 2e-58 | PREDICTED: agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 6e-35 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | A0A2P5YIH9 | 5e-71 | A0A2P5YIH9_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.011G189000.1 | 1e-59 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM70 | 28 | 415 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 3e-37 | AGAMOUS-like 80 |
Publications ? help Back to Top | |||
---|---|---|---|
|