PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A10G1445

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

M-type_MADS

Protein Properties

Length: 106aa MW: 12120.4 Da PI: 10.5438

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A10G1445	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	42.6	8e-14	11	50	3	42
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 i n+s r+ t+ +R +g+ KK +E+S+LC+++ + i++s+ Gh_A10G1445 11 ITNNSARKATYKNRMKGLTKKMSEMSTLCGVDTCAIMYSP 50 89*************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	14.283	1	49	IPR002100	Transcription factor, MADS-box
SMART	SM00432	8.7E-15	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.09E-21	1	85	IPR002100	Transcription factor, MADS-box
CDD	cd00266	2.66E-24	2	85	No hit	No description
Pfam	PF00319	3.9E-15	11	52	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MTRKKVKLTY ITNNSARKAT YKNRMKGLTK KMSEMSTLCG VDTCAIMYSP YKSPPEVWPS 60 PMGVQQVLSK LETIPEMEKS KNMLNQKTFL SQKITKAAEQ LKNHCK

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269\|PubMed:16798889}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269\|PubMed:16798889, ECO:0000305\|PubMed:26462908}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016740176.1	2e-58	PREDICTED: agamous-like MADS-box protein AGL80
Swissprot	Q9FJK3	6e-35	AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBL	A0A2P5YIH9	5e-71	A0A2P5YIH9_GOSBA; Uncharacterized protein
STRING	Gorai.011G189000.1	1e-59	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM70	28	415

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G48670.1	3e-37	AGAMOUS-like 80

Publications ? help Back to Top
Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]