PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A08G0476 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 168aa MW: 19565.9 Da PI: 6.1514 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 49.2 | 1.1e-15 | 74 | 126 | 5 | 57 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 +++rr+++NRe+ArrsR RK+ ++eL v L +eN++L+++l++ ++ + Gh_A08G0476 74 RKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHVSESHD 126 689***************************************99999887655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.880.10 | 3.1E-5 | 32 | 88 | IPR008917 | Transcription factor, Skn-1-like, DNA-binding domain |
SMART | SM00338 | 1.4E-14 | 70 | 134 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.588 | 72 | 135 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.05E-13 | 74 | 124 | No hit | No description |
Pfam | PF00170 | 2.1E-13 | 74 | 126 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 8.38E-19 | 75 | 126 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 77 | 92 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 2.4E-12 | 89 | 147 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MQPSEISGLQ YIVPSNPSPY SVPAFELSRF SNPLHNLYIP PQLQEIISPH PSCINNNSTS 60 DEADEQQLCV INERKQRRMI SNRESARRSR MRKQRHLDEL WSQVVWLRNE NHQLIDKLNH 120 VSESHDKVVE ENVQLKEEAS QLRRMLSDMQ LTSPYSPLTD LEHALADN |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 86 | 93 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016744543.1 | 1e-120 | PREDICTED: basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 1e-44 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A1U8P2F9 | 1e-118 | A0A1U8P2F9_GOSHI; basic leucine zipper 43-like | ||||
TrEMBL | A0A2P5XPH3 | 1e-118 | A0A2P5XPH3_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.004G063800.1 | 1e-116 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 3e-52 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|