PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A06G1863 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 207aa MW: 23359.6 Da PI: 8.4622 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.7e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l+ +++ +G+g +W + ++++g++R++k+c++rw++yl Gh_A06G1863 14 KGPWSPEEDAKLKAYIEHYGTGgNWISLPQKIGLKRCGKSCRLRWLNYL 62 79*********************************************97 PP | |||||||
2 | Myb_DNA-binding | 40.1 | 8.4e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eEde++ + G++ W+ Ia+ ++ gRt++++k++w++ Gh_A06G1863 69 GGFSEEEDEIICSLYLSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111 569******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.275 | 9 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.72E-27 | 11 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-12 | 13 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-15 | 14 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.4E-25 | 15 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.70E-10 | 16 | 62 | No hit | No description |
PROSITE profile | PS51294 | 21.747 | 63 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 5.9E-11 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-11 | 69 | 111 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-24 | 70 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.32E-8 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE HYGTGGNWIS LPQKIGLKRC GKSCRLRWLN 60 YLRPNIKHGG FSEEEDEIIC SLYLSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR 120 YPRPEPPFPV VPVPYSSQGQ SIQFTNSQCS VVDGANMEQH MLQGQTSSSS LNGMGLFYGE 180 DIINDTSSLV CFGMFQHYAF YDHISLQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-26 | 14 | 117 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Accumulates in an adaxial ball-shaped set of cells in three to five cell layers around the L3 layer of the shoot apical meristem (SAM) in youg plantlets. In the inflorescence meristem, confined to the axils of flower primordia. {ECO:0000269|PubMed:16461581}. | |||||
Uniprot | DEVELOPMENTAL STAGE: In roots, expressed in endodermal cells from the late elongation zones to the differentiation zone and, to a lower extent, in endodermal cells of the meristematic zone. {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves, roots (endodermis-specific) and seedlings. {ECO:0000269|PubMed:16461581, ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322, ECO:0000269|PubMed:9839469}. | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16461581}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence. {ECO:0000250, ECO:0000269|PubMed:16461581}. | |||||
UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM052724 | 0.0 | KM052724.1 Gossypium hirsutum RAX-like transcription factor RAX5 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016717721.1 | 1e-156 | PREDICTED: transcription factor RAX3-like | ||||
Swissprot | Q9FKL2 | 9e-80 | MYB36_ARATH; Transcription factor MYB36 | ||||
Swissprot | Q9M2Y9 | 8e-80 | RAX3_ARATH; Transcription factor RAX3 | ||||
TrEMBL | A0A1U8LT14 | 1e-154 | A0A1U8LT14_GOSHI; transcription factor RAX3-like | ||||
STRING | Gorai.010G028800.1 | 1e-137 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G57620.1 | 1e-82 | myb domain protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|