PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A06G0136 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 195aa MW: 21819.4 Da PI: 8.3273 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.3 | 2.7e-16 | 19 | 64 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd l ++v+++G +W++I+r++ gR++k+c++rw + Gh_A06G0136 19 KGPWSAEEDRVLTRLVERYGAWNWSLISRYIK-GRSGKSCRLRWCNQ 64 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 49.6 | 9.1e-16 | 73 | 115 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+ Ede ++ a+ +G++ W+tIa+ ++ gRt++ +k++w++ Gh_A06G0136 73 PFTKAEDETILAAHCVYGNR-WATIAKLLP-GRTDNAVKNHWNST 115 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.902 | 14 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.03E-31 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-13 | 18 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.5E-24 | 20 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.70E-12 | 21 | 63 | No hit | No description |
Pfam | PF13921 | 1.0E-16 | 22 | 80 | No hit | No description |
PROSITE profile | PS51294 | 23.763 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 2.5E-13 | 70 | 118 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-22 | 73 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.54E-10 | 73 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MNGCSSSSDT SSSESSRIKG PWSAEEDRVL TRLVERYGAW NWSLISRYIK GRSGKSCRLR 60 WCNQLSPDVE HRPFTKAEDE TILAAHCVYG NRWATIAKLL PGRTDNAVKN HWNSTLKRRI 120 REQKTEQKGS VVVDEEEVLT ALTLAPPGSG GGLTVEGRRE EEVTAEFWDA MKGVIASEVR 180 DYMSSTLSSN TSKLH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-41 | 18 | 120 | 6 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016729230.1 | 1e-142 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | Q9FDW1 | 1e-52 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A1U8MQY7 | 1e-141 | A0A1U8MQY7_GOSHI; transcription factor MYB44-like | ||||
STRING | Gorai.010G016800.1 | 1e-122 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14553 | 11 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 1e-54 | myb domain protein r1 |