PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A03G1551 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 211aa MW: 23866.3 Da PI: 9.642 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.5 | 7.3e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n rqvtfskRr g++KKA+ELSvLCdae+a+i+fs+tgkl++yss Gh_A03G1551 9 KKIDNVAARQVTFSKRRRGLFKKAHELSVLCDAEIALIVFSTTGKLFDYSS 59 689**********************************************96 PP | |||||||
2 | K-box | 47.8 | 6.3e-17 | 106 | 173 | 32 | 99 |
K-box 32 qreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +++R+l+Ge+L+ L ++ L++Le+ +e +l+++ ++K+e ++++i++l++k el een++L++++e Gh_A03G1551 106 THQLRQLKGEELQGLGYEGLNHLEKLVEGGLRRVTETKDERFFKEISTLKMKGAELVEENQQLKQQME 173 4688*************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.829 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.2E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.79E-30 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.96E-40 | 3 | 74 | No hit | No description |
PRINTS | PR00404 | 2.4E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.821 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.5E-14 | 95 | 172 | IPR002487 | Transcription factor, K-box |
Gene3D | G3DSA:1.20.142.10 | 9.1E-4 | 101 | 202 | IPR004102 | Poly(ADP-ribose) polymerase, regulatory domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006471 | Biological Process | protein ADP-ribosylation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003950 | Molecular Function | NAD+ ADP-ribosyltransferase activity | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MTRKRIQIKK IDNVAARQVT FSKRRRGLFK KAHELSVLCD AEIALIVFST TGKLFDYSSA 60 SMEKVIERRN QQSGKGIDRA VTSPYHGLQV GSRTCVMLSK EMAEKTHQLR QLKGEELQGL 120 GYEGLNHLEK LVEGGLRRVT ETKDERFFKE ISTLKMKGAE LVEENQQLKQ QMENLPHMVH 180 VQPSESIAHA GSSENPIQPY DNSQDISLTL G |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 9e-22 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 9e-22 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 9e-22 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 9e-22 | 1 | 66 | 1 | 66 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During vegetative phase expressed in young leaves and apical meristem until early stage of bolting. Early in development of the inflorescence present in the coflorescence and flower primordia but not in the main apical meristem. Present throughout the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. {ECO:0000269|PubMed:19656343}. | |||||
Uniprot | TISSUE SPECIFICITY: Detected in roots and leaves. Expressed at very low levels in flowers and siliques. Present in floral meristems. {ECO:0000269|PubMed:19656343}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC155634 | 0.0 | KC155634.1 Gossypium hirsutum MADS box protein MADS39 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016666625.1 | 1e-155 | PREDICTED: MADS-box protein SVP-like isoform X2 | ||||
Refseq | XP_016666626.1 | 1e-155 | PREDICTED: MADS-box protein SVP-like isoform X2 | ||||
Swissprot | Q9FUY6 | 2e-61 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
Swissprot | Q9FVC1 | 1e-61 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1U8HKP1 | 1e-154 | A0A1U8HKP1_GOSHI; MADS-box protein SVP-like isoform X2 | ||||
STRING | Gorai.005G225500.1 | 1e-139 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM28332 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 6e-52 | MIKC_MADS family protein |