PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_A01G0298

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NAC

Protein Properties

Length: 66aa MW: 7688.68 Da PI: 4.5027

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_A01G0298	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	64.1	4.2e-20	11	61	1	52
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52 lppGfrFhPtdeel+++yLk+++++k++++ ++i+evdiyk++Pw+Lp k++ Gh_A01G0298 11 LPPGFRFHPTDEELIMFYLKNQAKSKPCPV-SIIPEVDIYKFDPWQLPDKAE 61 79**************************.89************96554 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.09E-22	8	65	IPR003441	NAC domain
PROSITE profile	PS51005	22.225	11	66	IPR003441	NAC domain
Pfam	PF02365	2.5E-8	12	53	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MDRNTSSKSD LPPGFRFHPT DEELIMFYLK NQAKSKPCPV SIIPEVDIYK FDPWQLPDKA 60 EFGENE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-20	2	66	6	70	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at the base of the inflorescence meristem and at late stages of development in petals and stamens. Up-regulated during leaf senescence. {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:9489703}.
Uniprot	TISSUE SPECIFICITY: Expressed in senescing leaves, petals and sepals. {ECO:0000269\|PubMed:16640597}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:25516602}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:24659488, ECO:0000269\|PubMed:25516602, ECO:0000269\|PubMed:9489703}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ914140	3e-64	JQ914140.1 Gossypium hirsutum NAC domain protein 9 (NAC9) mRNA, complete cds.
GenBank	KP203895	3e-64	KP203895.1 Gossypium hirsutum putative NAC transcription factor (SNAC1) mRNA, complete cds.
GenBank	KP300008	3e-64	KP300008.1 Gossypium hirsutum cultivar CCRI10 NAP (NAP) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012438548.1	5e-41	PREDICTED: NAC transcription factor 29-like
Refseq	XP_016703840.1	6e-41	PREDICTED: NAC transcription factor 29-like
Refseq	XP_016736202.1	5e-41	PREDICTED: NAC transcription factor 29-like
Refseq	XP_017636405.1	6e-41	PREDICTED: NAC transcription factor 29
Swissprot	O49255	7e-33	NAC29_ARATH; NAC transcription factor 29
TrEMBL	A0A0D2T814	2e-40	A0A0D2T814_GOSRA; Uncharacterized protein
TrEMBL	A0A2P5VWE5	9e-41	A0A2P5VWE5_GOSBA; Uncharacterized protein
STRING	Gorai.008G179900.1	2e-40	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7967	13	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	3e-35	NAC-like, activated by AP3/PI

Publications ? help Back to Top
Zhang K,Gan SS An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves. Plant Physiol., 2012. 158(2): p. 961-9 [PMID:22184656] Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12 [PMID:23959884] Shinozaki Y, et al. Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span. J. Plant Physiol., 2014. 171(8): p. 633-8 [PMID:24709156] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200]