PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS70852.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 87aa MW: 10010.4 Da PI: 9.6052 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.9 | 2.2e-41 | 4 | 81 | 1 | 78 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +C ve+C adls +k+yh+rhkvCevh+k+pvvlv+g++qrfCqqCsrfhe+s+fD++krsCrrrLa+hnerrrk++a EPS70852.1 4 CCLVEDCGADLSACKKYHQRHKVCEVHAKSPVVLVDGIRQRFCQQCSRFHEVSQFDHTKRSCRRRLAGHNERRRKSTA 81 6**************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 31.419 | 2 | 79 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 1.1E-31 | 2 | 66 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 6.93E-38 | 3 | 83 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.3E-32 | 5 | 78 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
ASPCCLVEDC GADLSACKKY HQRHKVCEVH AKSPVVLVDG IRQRFCQQCS RFHEVSQFDH 60 TKRSCRRRLA GHNERRRKST AESQKQG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 2e-31 | 5 | 78 | 11 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011082696.1 | 6e-48 | squamosa promoter-binding protein 2-like | ||||
Swissprot | Q38740 | 2e-46 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
TrEMBL | S8EEA5 | 4e-56 | S8EEA5_9LAMI; Squamosa promoter-binding protein 2 (Fragment) | ||||
STRING | XP_006464784.1 | 1e-42 | (Citrus sinensis) | ||||
STRING | XP_006451806.1 | 1e-42 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 9e-38 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|