PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS68410.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 151aa MW: 17034.5 Da PI: 10.7426 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 54.6 | 1.4e-17 | 86 | 120 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C +C + kTp+WR+gp g+ktLCnaCG++y++ +l EPS68410.1 86 CWHCESDKTPQWREGPMGPKTLCNACGVRYKSGRL 120 99*****************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 5.4E-15 | 80 | 130 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 8.55E-15 | 83 | 143 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 9.9E-15 | 84 | 118 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE profile | PS50114 | 10.726 | 84 | 116 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 1.10E-11 | 85 | 132 | No hit | No description |
Pfam | PF00320 | 1.3E-15 | 86 | 120 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 86 | 111 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
EEELEWLSNR DAFPPLESCF GILSDNPNLI PNQTSPVSVL RSAKPPPSKP RTLRSRKRRT 60 TFTTPVVKEA SSSAAAASEV GMRKRCWHCE SDKTPQWREG PMGPKTLCNA CGVRYKSGRL 120 LPEYRPANSP TFCSLLHSNS HRKVVQMRKR K |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 54 | 59 | SRKRRT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00377 | DAP | Transfer from AT3G24050 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011073745.1 | 7e-55 | GATA transcription factor 1-like | ||||
Swissprot | Q6DBP8 | 1e-35 | GAT11_ARATH; GATA transcription factor 11 | ||||
Swissprot | Q8LAU9 | 9e-36 | GATA1_ARATH; GATA transcription factor 1 | ||||
TrEMBL | S8CNX3 | 1e-106 | S8CNX3_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.G00615.1.p | 3e-53 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4076 | 24 | 45 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24050.1 | 1e-36 | GATA transcription factor 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|