PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS67843.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 117aa MW: 13397.1 Da PI: 10.5093 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 80.7 | 1.3e-25 | 64 | 108 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e+ EPS67843.1 64 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVEQ 108 79****************************************997 PP | |||||||
2 | QLQ | 63.2 | 6.5e-22 | 3 | 39 | 1 | 37 |
QLQ 1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 ++FTa+Q+++L++Q+l+yKy++an+P+P++Ll +i+k EPS67843.1 3 GPFTASQWMELEHQALIYKYINANVPIPSYLLDPIRK 39 59*********************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 1.8E-11 | 3 | 39 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 2.4E-16 | 4 | 38 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 22.758 | 4 | 39 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 25.417 | 64 | 108 | IPR014977 | WRC domain |
Pfam | PF08879 | 5.3E-22 | 65 | 107 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
VRGPFTASQW MELEHQALIY KYINANVPIP SYLLDPIRKP FQSAAFRSTP FGWGGFQLGF 60 SNSDPEPGRC RRTDGKKWRC SRDAVADQKY CERHMNRGRH RSRKPVEQQS GHAASSS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011074333.2 | 4e-66 | growth-regulating factor 6 | ||||
Swissprot | Q6AWY3 | 4e-55 | GRF6_ORYSJ; Growth-regulating factor 6 | ||||
TrEMBL | S8DX63 | 4e-83 | S8DX63_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | PGSC0003DMT400012666 | 2e-61 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1688 | 23 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37740.1 | 7e-55 | growth-regulating factor 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|