PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS65844.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 73aa MW: 8894.12 Da PI: 11.1549 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 69.9 | 3.1e-22 | 10 | 68 | 3 | 56 |
--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 +R+++t+eql+ Leel+++ +r+ps e++++++ +l +++ ++V++WFqN++a+e+ EPS65844.1 10 SRWCPTPEQLQSLEELYRRgTRTPSSEQIQQITCQLrrygKIEAKNVFYWFQNHKARER 68 7*****************99*************************************98 PP | |||||||
2 | Wus_type_Homeobox | 115.3 | 3e-37 | 9 | 70 | 3 | 64 |
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 ++RW+PtpeQ++ Leely++G+rtP++e+iq+it +L++yGkie kNVfyWFQN+kaRer k EPS65844.1 9 SSRWCPTPEQLQSLEELYRRGTRTPSSEQIQQITCQLRRYGKIEAKNVFYWFQNHKARERLK 70 79**********************************************************88 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00389 | 0.0065 | 7 | 73 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 4.6E-20 | 10 | 68 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.75E-12 | 10 | 68 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 8.5E-10 | 10 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 9.39E-4 | 11 | 68 | No hit | No description |
PROSITE profile | PS50071 | 10.981 | 15 | 70 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
VNSQQVVVSS RWCPTPEQLQ SLEELYRRGT RTPSSEQIQQ ITCQLRRYGK IEAKNVFYWF 60 QNHKARERLK RRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor which may be involved in developmental processes. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012853221.1 | 1e-38 | PREDICTED: WUSCHEL-related homeobox 1-like | ||||
Swissprot | Q6X7K0 | 1e-33 | WOX1_ARATH; WUSCHEL-related homeobox 1 | ||||
TrEMBL | S8CG27 | 7e-46 | S8CG27_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.D01555.1.p | 5e-38 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4681 | 23 | 42 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18010.1 | 4e-36 | WUSCHEL related homeobox 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|