PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS64773.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 120aa MW: 14123.8 Da PI: 11.6334 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 36.1 | 1.4e-11 | 31 | 78 | 2 | 49 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 +e++r rr+++NRe+A+rsR RKk+ e + L+ eN+ Lk++l EPS64773.1 31 AEDRRRRRMISNRESAKRSRIRKKQHAEDVVSEWNRLQVENRGLKNRL 78 6899*****************************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.6E-11 | 29 | 78 | No hit | No description |
SMART | SM00338 | 1.5E-8 | 30 | 94 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.7E-9 | 31 | 78 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.726 | 32 | 78 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.17E-9 | 34 | 78 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 37 | 52 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 4.43E-9 | 39 | 80 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
PFEIHDIFSF LDSDSPPPEN PASSTSAAAA AEDRRRRRMI SNRESAKRSR IRKKQHAEDV 60 VSEWNRLQVE NRGLKNRLCA FDWHRRSARI DSESLVHEST RLRIRLDGLR RLLQHRAQQQ |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | S8DP14 | 4e-80 | S8DP14_9LAMI; Uncharacterized protein (Fragment) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2820 | 22 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 1e-09 | basic leucine-zipper 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|