PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS59646.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 178aa MW: 20276.3 Da PI: 10.7179 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 92.8 | 2.9e-29 | 21 | 75 | 1 | 56 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 kp+++WtpeLH+rFv+aveqL G +kA+P++ilelm +++Lt+++v+SHLQkYR++ EPS59646.1 21 KPKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMRIDCLTRHNVASHLQKYRSH 75 79*******************.********************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.716 | 18 | 77 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-28 | 19 | 78 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.27E-20 | 19 | 78 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.4E-27 | 21 | 75 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 5.6E-8 | 24 | 73 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007165 | Biological Process | signal transduction | ||||
GO:0009658 | Biological Process | chloroplast organization | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010380 | Biological Process | regulation of chlorophyll biosynthetic process | ||||
GO:0010638 | Biological Process | positive regulation of organelle organization | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1900056 | Biological Process | negative regulation of leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
KDENKPKKSI PSSKNATGKK KPKVDWTPEL HRRFVQAVEQ LGVDKAVPSR ILELMRIDCL 60 TRHNVASHLQ KYRSHRKHLL AREAVAASWN QRRKIISSGK KDHVSPWITP PPTTTIGFPP 120 MPPLHVWGHP SLDQSLMHTW PKHNHPPPSP PSWPPTPVDP QLEFFYAPIS NCDSNFSP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 1e-19 | 17 | 73 | 1 | 57 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00022 | PBM | Transfer from AT2G20570 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021279775.1 | 5e-66 | transcription activator GLK1 | ||||
Swissprot | Q9SIV3 | 1e-52 | GLK1_ARATH; Transcription activator GLK1 | ||||
TrEMBL | S8C5C7 | 1e-126 | S8C5C7_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.M00147.1.p | 3e-63 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2532 | 23 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G20570.1 | 3e-44 | GBF's pro-rich region-interacting factor 1 |