PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS59231.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

NAC

Protein Properties

Length: 147aa MW: 17139.2 Da PI: 9.4146

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS59231.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	101.4	1.2e-31	3	79	51	128
NAM 51 vkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +k+++++w+fFs+rd+ky++g r+nratk gyWkatgkd+ + g+ glkktLvfy+grap+ge+tdWvmhey++ EPS59231.1 3 LKTGDRQWFFFSPRDRKYPNGGRSNRATKYGYWKATGKDRVISY-AGRPAGLKKTLVFYRGRAPNGERTDWVMHEYTM 79 567899**********************************99.999**************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	36.755	1	102	IPR003441	NAC domain
SuperFamily	SSF101941	2.75E-36	4	102	IPR003441	NAC domain
Pfam	PF02365	6.6E-15	9	78	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
SKLKTGDRQW FFFSPRDRKY PNGGRSNRAT KYGYWKATGK DRVISYAGRP AGLKKTLVFY 60 RGRAPNGERT DWVMHEYTMD ESELKRCVDV KEYYALYKAF KKSGPGPKNG EQYGAPFNEE 120 DWENDDLQVQ CFDFIEKPVK HSDETAP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-30	6	108	69	171	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-30	6	108	69	171	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-30	6	108	69	171	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-30	6	108	69	171	NO APICAL MERISTEM PROTEIN
4dul_A	2e-30	6	108	69	171	NAC domain-containing protein 19
4dul_B	2e-30	6	108	69	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269\|PubMed:24045017}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold and drought stresses. {ECO:0000269\|PubMed:17158162}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011074130.1	2e-77	NAC domain-containing protein 17-like
Swissprot	Q9XIC5	2e-67	NAC17_ARATH; NAC domain-containing protein 17
TrEMBL	S8C481	1e-106	S8C481_9LAMI; Nam-like protein 7 (Fragment)
STRING	XP_002527114.1	1e-73	(Ricinus communis)
STRING	Migut.N02932.1.p	2e-73	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3212	24	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G34190.1	8e-70	NAC domain containing protein 17

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Van Aken O, et al. Mitochondrial and Chloroplast Stress Responses Are Modulated in Distinct Touch and Chemical Inhibition Phases. Plant Physiol., 2016. 171(3): p. 2150-65 [PMID:27208304] Van Aken O,Ford E,Lister R,Huang S,Millar AH Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance. Plant J., 2016. 88(4): p. 542-558 [PMID:27425258] Hu Z, et al. Mitochondrial Defects Confer Tolerance against Cellulose Deficiency. Plant Cell, 2016. 28(9): p. 2276-2290 [PMID:27543091] Chi YH, et al. The membrane-tethered NAC transcription factor, AtNTL7, contributes to ER-stress resistance in Arabidopsis. Biochem. Biophys. Res. Commun., 2017. 488(4): p. 641-647 [PMID:28088515] Van Aken O,Pogson BJ Convergence of mitochondrial and chloroplastic ANAC017/PAP-dependent retrograde signalling pathways and suppression of programmed cell death. Cell Death Differ., 2017. 24(6): p. 955-960 [PMID:28498364] Cheng P, et al. The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis. Front Plant Sci, 2018. 9: p. 182 [PMID:29497438]