PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS58809.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 135aa MW: 15528.9 Da PI: 8.4952 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 81.8 | 4.4e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqv fskRr g++KKA+ELS+LCdae+ +++fsstgkl++y+s EPS58809.1 9 KKIDNVTARQVAFSKRRRGLFKKAHELSTLCDAEIGLVVFSSTGKLFDYAS 59 68***********************************************86 PP | |||||||
2 | K-box | 31.2 | 9.3e-12 | 75 | 133 | 7 | 65 |
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkki 65 +s+e+++++ ++ +a + ke+ ++hl+Ged+e+L + eL++Le+ +e++l+++ EPS58809.1 75 ESNETTHMKVTHNWYASMGKELMDRTVDLKHLMGEDIEELGISELMKLEKTVETGLNRV 133 44666666777777777777777777889****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.819 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.3E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.62E-38 | 3 | 76 | No hit | No description |
SuperFamily | SSF55455 | 4.58E-30 | 3 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.7E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.0E-7 | 78 | 133 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 7.192 | 82 | 135 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MVRQKIEIKK IDNVTARQVA FSKRRRGLFK KAHELSTLCD AEIGLVVFSS TGKLFDYASS 60 SMPELIRRHN MVSEESNETT HMKVTHNWYA SMGKELMDRT VDLKHLMGED IEELGISELM 120 KLEKTVETGL NRVEK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_B | 2e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_C | 2e-19 | 1 | 74 | 1 | 74 | MEF2C |
5f28_D | 2e-19 | 1 | 74 | 1 | 74 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012828389.1 | 2e-59 | PREDICTED: MADS-box protein SVP-like | ||||
Swissprot | Q9FVC1 | 8e-45 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | S8BWR0 | 3e-94 | S8BWR0_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.B00557.1.p | 9e-59 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 3e-47 | MIKC_MADS family protein |