PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS57246.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 52aa MW: 6013.76 Da PI: 9.1945 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 72.7 | 1.3e-22 | 1 | 38 | 132 | 169 |
YABBY 132 fikeeiqrikasnPdishreafsaaaknWahfPkihfg 169 f +eeiqrikasnP+ishr+afs+aaknWah+P+ih g EPS57246.1 1 FFREEIQRIKASNPEISHRQAFSTAAKNWAHYPDIHIG 38 889*********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.4E-21 | 1 | 39 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 52 aa Download sequence Send to blast |
FFREEIQRIK ASNPEISHRQ AFSTAAKNWA HYPDIHIGMK MEASPPTKTT DQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010557447.1 | 5e-20 | PREDICTED: putative axial regulator YABBY 2 | ||||
Swissprot | Q9XFB0 | 3e-20 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | S8BYJ5 | 5e-31 | S8BYJ5_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_010557447.1 | 2e-19 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA381 | 24 | 163 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 1e-22 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|