PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS57111.1
Organism
Genlisea aurea
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GATA
Protein Properties Length: 64aa    MW: 7153.36 Da    PI: 10.5741
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS57111.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.51e-19235134
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                C +C  tkTp+WR+gp+g+ktLCnaCG+++++ +
  EPS57111.1  2 CLHCEITKTPQWRSGPSGPKTLCNACGVRFKSGR 35
                99*****************************987 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.912132IPR000679Zinc finger, GATA-type
CDDcd002021.02E-12148No hitNo description
SMARTSM004015.0E-13146IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-16259No hitNo description
PROSITE patternPS003440227IPR000679Zinc finger, GATA-type
PfamPF003203.3E-17236IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.3E-16234IPR013088Zinc finger, NHR/GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
KCLHCEITKT PQWRSGPSGP KTLCNACGVR FKSGRLFPEY RPAASPTFVP ALHSNSHKKV  60
IEMR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347480.28e-39GATA transcription factor 8-like
RefseqXP_009344766.19e-39PREDICTED: GATA transcription factor 8-like
RefseqXP_023929596.17e-39GATA transcription factor 8-like
RefseqXP_024176635.18e-39GATA transcription factor 8-like
SwissprotQ9SV301e-38GATA8_ARATH; GATA transcription factor 8
TrEMBLA0A2P6SJF02e-37A0A2P6SJF0_ROSCH; GATA transcription factor
TrEMBLA0A498JKE42e-37A0A498JKE4_MALDO; GATA transcription factor
TrEMBLS8BY653e-40S8BY65_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_009344766.14e-38(Pyrus x bretschneideri)
STRINGXP_008347480.13e-38(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31342149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.25e-41GATA family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  2. Choi D, et al.
    iNID: an analytical framework for identifying network models for interplays among developmental signaling in Arabidopsis.
    Mol Plant, 2014. 7(5): p. 792-813
    [PMID:24380880]
  3. Li T,Wu XY,Li H,Song JH,Liu JY
    A Dual-Function Transcription Factor, AtYY1, Is a Novel Negative Regulator of the Arabidopsis ABA Response Network.
    Mol Plant, 2016. 9(5): p. 650-661
    [PMID:26961720]