PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cotton_A_38757_BGI-A2_v1.0

Organism

Gossypium arboreum

Taxonomic ID

29729

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB_related

Protein Properties

Length: 147aa MW: 17299.9 Da PI: 10.3459

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cotton_A_38757_BGI-A2_v1.0	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.7	2.3e-17	41	85	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +WT+eE++++++a +++G g W+ I +++g ++++ q++s+ qk+ Cotton_A_38757_BGI-A2_v1.0 41 REKWTEEEHQRFLEALRLYGRG-WRQIEEHVG-TKSAVQIRSHAQKF 85 789*****************.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:3.30.170.10	1.3E-14	1	40	IPR000789	Cyclin-dependent kinase, regulatory subunit
SuperFamily	SSF55637	1.83E-14	2	41	IPR000789	Cyclin-dependent kinase, regulatory subunit
SMART	SM01084	3.6E-10	3	54	IPR000789	Cyclin-dependent kinase, regulatory subunit
PRINTS	PR00296	2.0E-9	3	17	IPR000789	Cyclin-dependent kinase, regulatory subunit
Pfam	PF01111	5.9E-14	4	40	IPR000789	Cyclin-dependent kinase, regulatory subunit
PROSITE pattern	PS00944	0	6	24	IPR000789	Cyclin-dependent kinase, regulatory subunit
PRINTS	PR00296	2.0E-9	18	32	IPR000789	Cyclin-dependent kinase, regulatory subunit
PROSITE profile	PS51294	19.28	36	90	IPR017930	Myb domain
SuperFamily	SSF46689	8.22E-16	38	89	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.1E-16	39	88	IPR006447	Myb domain, plants
SMART	SM00717	1.9E-12	40	88	IPR001005	SANT/Myb domain
Pfam	PF00249	2.7E-15	41	84	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.1E-9	41	81	IPR009057	Homeodomain-like
CDD	cd00167	1.12E-10	43	86	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007049	Biological Process	cell cycle
GO:0003677	Molecular Function	DNA binding
GO:0016538	Molecular Function	cyclin-dependent protein serine/threonine kinase regulator activity

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
MGQIQYSEKY FDDTYEYRHV VLPPEVAKLL PKNRLLSENQ REKWTEEEHQ RFLEALRLYG 60 RGWRQIEEHV GTKSAVQIRS HAQKFFSKVV RESNGGFDGS IKPVVIPPPH LKRKPVHPYP 120 RKFVNLVKGI FISRIFISSL INLNNQC

Functional Description ? help Back to Top
Source	Description
UniProt	Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012469152.1	3e-47	PREDICTED: protein REVEILLE 7-like isoform X2
Refseq	XP_012469158.1	3e-47	PREDICTED: protein REVEILLE 7-like isoform X2
Refseq	XP_016744075.1	2e-47	PREDICTED: protein REVEILLE 7-like isoform X3
Refseq	XP_016744076.1	2e-47	PREDICTED: protein REVEILLE 7-like isoform X3
Refseq	XP_016744077.1	2e-47	PREDICTED: protein REVEILLE 7-like isoform X3
Refseq	XP_016744078.1	2e-47	PREDICTED: protein REVEILLE 7-like isoform X3
Swissprot	F4KGY6	9e-35	RVE1_ARATH; Protein REVEILLE 1
TrEMBL	A0A2P5YMN5	3e-93	A0A2P5YMN5_GOSBA; Cyclin-dependent kinases regulatory subunit
STRING	Gorai.001G069700.1	2e-46	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6356	26	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G17300.1	6e-37	MYB_related family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu G, et al. REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis. Photosyn. Res., 2015. 126(2-3): p. 331-40 [PMID:25910753] Jiang Z,Xu G,Jing Y,Tang W,Lin R Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis. Nat Commun, 2016. 7: p. 12377 [PMID:27506149]